4FQ3: Transportin/FUS-NLS

Crystal structure of transportin/FUS-NLS. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Aug 2013.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,805
Mol. weight: 105.39 kDa
Released: 21 Aug 2013

Explore 4FQ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FQ3 contains 60 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 59 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
α-helix	27-40	14
α-helix	44-51	8
α-helix	52-56	5
α-helix	62-77	16
α-helix	86-97	12
α-helix	104-120	17
α-helix	129-137	9
α-helix	142-158	17
α-helix	161-164	4
β-strand	167	1	1
β-strand	169	1	1
α-helix	172-181	10
α-helix	188-199	12
α-helix	207-211	5
α-helix	213-223	11
α-helix	229-245	17
α-helix	247-250	4
α-helix	251-253	3
α-helix	254-265	12
α-helix	270-283	14
α-helix	289-292	4
α-helix	297-307	11
α-helix	310-311	2
α-helix	312-317	6
α-helix	375-390	16
α-helix	391-394	4
α-helix	395-406	12
α-helix	411-432	22
α-helix	433-435	3
α-helix	436-446	11
α-helix	452-471	20
α-helix	478-489	12
α-helix	494-510	17
α-helix	516-518	3
α-helix	519-532	14
α-helix	538-552	15
α-helix	553-556	4
α-helix	559-574	16
α-helix	583-597	15
α-helix	598-601	4
α-helix	602-628	27
α-helix	639-652	14
α-helix	660-663	4
α-helix	668-675	8
α-helix	681-697	17
α-helix	703-705	3
α-helix	706-715	10
α-helix	722-739	18
α-helix	740-743	4
α-helix	751-758	8
α-helix	765-781	17
α-helix	795-801	7
α-helix	805	1
β-strand	807	1	2
α-helix	808-823	16
α-helix	825-829	5
α-helix	833-839	7
α-helix	847-864	18
α-helix	870-873	4
α-helix	878-883	6
α-helix	884-888	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	514-520	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1	A	protein	890	Homo sapiens	Q92973 (AlphaFold model)
Fusion (Involved in t(12;16) in malignant liposarcoma)	B	protein	37	Homo sapiens	P35637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FQ3_1 Transportin-1 (chains A)
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDD
DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHEWVVKESGILV
LGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKP
LMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLI
LYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSG
FLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIE
QLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPE
FISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGY
VCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVA
SWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>4FQ3_2 Fusion (Involved in t(12;16) in malignant liposarcoma) (chains B)
GPLGSRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Primary citation

Crystal structure of transportin/FUS-NLS. Gong, W., Niu, C., Jia, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
5TQC 3.0 Å, Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of…
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
5J3V 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail

Browse structure collections

About this viewer

MolViewer shows 4FQ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.