4GPA: GluA4 N-terminal domain

High resolution structure of the GluA4 N-terminal domain (NTD). Determined by X-ray diffraction at 2.25 Å resolution. Released 24 Oct 2012.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 3,332
Mol. weight: 45.62 kDa
Ligands: NAG
Released: 24 Oct 2012

Explore 4GPA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GPA contains 14 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
α-helix	17-31	15
β-strand	42-49	8	1
α-helix	55-67	13
β-strand	72-75	4	1
α-helix	82-91	10
β-strand	95-98	4	1
β-strand	110-112	3	1
α-helix	115-116	2
α-helix	118-127	10
β-strand	132-137	6	2
α-helix	144-154	11
β-strand	159-164	6	2
α-helix	170-183	14
β-strand	187-191	5	2
α-helix	194-207	14
β-strand	211	1	3
β-strand	215-218	4	2
β-strand	222	1	2
α-helix	223-225	3
α-helix	229-234	6
β-strand	235	1	3
β-strand	237-242	6	2
α-helix	249-258	10
α-helix	272-274	3
α-helix	275-296	22
α-helix	321-329	9
β-strand	332-335	4	4
β-strand	338-341	4	4
β-strand	342	1	5
β-strand	348	1	5
β-strand	352-359	8	2
β-strand	362-370	9	2
β-strand	374-377	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor 4	A	protein	389	Rattus norvegicus	P19493 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GPA_1 Glutamate receptor 4 (chains A)
AFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTN
AFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGA
LLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEEL
DRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTG
FQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKID
ISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKS
TGPRKVGYWNDMDKLVLIQDRTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Comparative Dynamics of NMDA- and AMPA-Glutamate Receptor N-Terminal Domains. Dutta, A., Shrivastava, I.H., Sukumaran, M. et al. Structure (2012) 20:1838-1849. DOI 10.1016/j.str.2012.08.012 · PubMed

Other PDB entries of the same protein (UniProt P19493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FAS 1.4 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate…
3EPE 1.85 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with glutamate
3FAT 1.9 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-AMPA at…
3KEI 1.9 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with…
3KFM 2.2 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate
3EN3 2.43 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate
5FWX 2.5 Å, Crystal structure of the AMPA receptor GluA2/A4 N-terminal domain heterodimer
9QDN 2.71 Å, GluA4 in complex with TARP-2, resting state I, structure of TMD/LBD
9RMW 2.9 Å, GluA4 in complex with TARP-2, open state, structure of TMD/LBD domains
9RN7 3.1 Å, GluA4 in complex with TARP-2, Desensitized state, structure of TMD domain
9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD
9P9B 3.31 Å, Activated GluA4 homotetrameric AMPAR.

Browse structure collections

About this viewer

MolViewer shows 4GPA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.