4GRV: Neurotensin receptor NTS1

The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13). Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Oct 2012.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Rattus norvegicus, Enterobacteria phage T4
Chains: 2
Atoms: 3,546
Mol. weight: 58.5 kDa
Released: 17 Oct 2012

Explore 4GRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GRV contains 23 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	61-88	28
α-helix	99-115	17
α-helix	116-120	5
α-helix	121-127	7
α-helix	138-172	35
α-helix	174-181	8
α-helix	187-201	15
α-helix	204-207	4
β-strand	208-212	5	1
α-helix	220-222	3
β-strand	223-227	5	1
α-helix	231-242	12
α-helix	243-247	5
α-helix	248-265	18
α-helix	1003-1010	8
β-strand	1014-1015	2	2
β-strand	1016	1	3
β-strand	1017-1019	3	2
β-strand	1025-1028	4	2
β-strand	1031-1032	2	2
α-helix	1039-1044	6
β-strand	1057	1	3
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1094-1111	18
α-helix	1115-1121	7
α-helix	1126-1134	9
α-helix	1143-1155	13
α-helix	1159-1161	3
α-helix	302-332	31
α-helix	341-373	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1, lysozyme chimera	A	protein	510	Rattus norvegicus, Enterobacteria phage T4	P00720, P20789 (AlphaFold model)
Neurotensin 8-13	B	protein	6		P20068 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GRV_1 Neurotensin receptor type 1, lysozyme chimera (chains A)
DYKDDDDATSTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARK
KSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDAC
TYATALNVASLSVARYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQN
RSADGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVNIFE
MLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEK
LFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLNNKR
WDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSGSVQALRHGVLVARAVVIAFVV
CWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANFRQV
FLSTLACLCPGWRHRRKAHHHHHHHHHHGG

Sequence of entity 2 (B), FASTA

>4GRV_2 Neurotensin 8-13 (chains B)
RRPYIL

Primary citation

Structure of the agonist-bound neurotensin receptor. White, J.F., Noinaj, N., Shibata, Y. et al. Nature (2012) 490:508-513. DOI 10.1038/nature11558 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 4GRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.