4GUO: P73 DNA binding domain complex with 12 bp DNA
structure of p73 DNA binding domain complex with 12 bp DNA. Determined by X-ray diffraction at 3.19 Å resolution. Released 27 Nov 2013.
- Method
- X-ray diffraction
- Resolution
- 3.19 Å
- Organism
- Homo sapiens
- Chains
- 16
- Atoms
- 14,607
- Mol. weight
- 220.05 kDa
- Ligands
- ZN
- Released
- 27 Nov 2013
Explore 4GUO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4GUO contains 34 α-helices and 103 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 1 |
| β-strand | 128-130 | 3 | 2 |
| β-strand | 142-145 | 4 | 1 |
| β-strand | 150-153 | 4 | 1 |
| β-strand | 159-164 | 6 | 2 |
| α-helix | 168-170 | 3 | |
| β-strand | 174-181 | 8 | 1 |
| α-helix | 184-187 | 4 | |
| α-helix | 195-198 | 4 | |
| β-strand | 215-218 | 4 | 2 |
| β-strand | 224-227 | 4 | 1 |
| β-strand | 234-239 | 6 | 1 |
| β-strand | 250-256 | 7 | 2 |
| β-strand | 271-278 | 8 | 1 |
| β-strand | 284-294 | 11 | 1 |
| α-helix | 298-309 | 12 | |
Chain B: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 3 |
| β-strand | 128-130 | 3 | 4 |
| β-strand | 142-145 | 4 | 3 |
| β-strand | 150-153 | 4 | 3 |
| β-strand | 159-164 | 6 | 4 |
| β-strand | 174-181 | 8 | 3 |
| α-helix | 184-187 | 4 | |
| β-strand | 192 | 1 | 5 |
| α-helix | 195-199 | 5 | |
| β-strand | 213 | 1 | 5 |
| β-strand | 215-217 | 3 | 4 |
| β-strand | 224-227 | 4 | 3 |
| β-strand | 234-239 | 6 | 3 |
| α-helix | 242-244 | 3 | |
| β-strand | 250-256 | 7 | 4 |
| β-strand | 271-279 | 9 | 3 |
| β-strand | 283-294 | 12 | 3 |
| α-helix | 298-307 | 10 | |
Chain C: 4 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 6 |
| β-strand | 128-130 | 3 | 7 |
| β-strand | 142-145 | 4 | 6 |
| β-strand | 150-154 | 5 | 6 |
| β-strand | 159-164 | 6 | 7 |
| α-helix | 168-170 | 3 | |
| β-strand | 174-181 | 8 | 6 |
| α-helix | 184-187 | 4 | |
| β-strand | 192 | 1 | 8 |
| α-helix | 195-199 | 5 | |
| β-strand | 213 | 1 | 8 |
| β-strand | 215-217 | 3 | 7 |
| β-strand | 224-227 | 4 | 6 |
| β-strand | 234-239 | 6 | 6 |
| β-strand | 250-256 | 7 | 7 |
| β-strand | 271-278 | 8 | 6 |
| β-strand | 284-295 | 12 | 6 |
| α-helix | 298-310 | 13 | |
Chain D: 3 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 9 |
| β-strand | 128-130 | 3 | 10 |
| β-strand | 142-145 | 4 | 9 |
| β-strand | 150-153 | 4 | 9 |
| β-strand | 159-164 | 6 | 10 |
| β-strand | 173-181 | 9 | 9 |
| α-helix | 195-199 | 5 | |
| β-strand | 215-218 | 4 | 10 |
| β-strand | 224-227 | 4 | 9 |
| β-strand | 234-239 | 6 | 9 |
| α-helix | 242-244 | 3 | |
| β-strand | 250-256 | 7 | 10 |
| β-strand | 271-279 | 9 | 9 |
| β-strand | 286-294 | 9 | 9 |
| α-helix | 298-309 | 12 | |
Chain I: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 11 |
| β-strand | 128-130 | 3 | 12 |
| β-strand | 142-145 | 4 | 11 |
| β-strand | 150-153 | 4 | 11 |
| β-strand | 159-164 | 6 | 12 |
| α-helix | 169-170 | 2 | |
| β-strand | 174-181 | 8 | 11 |
| β-strand | 190 | 1 | 11 |
| α-helix | 192-194 | 3 | |
| α-helix | 195-199 | 5 | |
| β-strand | 215-217 | 3 | 12 |
| β-strand | 224-227 | 4 | 11 |
| β-strand | 234-239 | 6 | 11 |
| α-helix | 242-244 | 3 | |
| β-strand | 250-256 | 7 | 12 |
| β-strand | 271-278 | 8 | 11 |
| β-strand | 284-294 | 11 | 11 |
| α-helix | 298-310 | 13 | |
Chain J: 8 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 128 | 1 | 13 |
| β-strand | 131 | 1 | 14 |
| α-helix | 132 | 1 | |
| α-helix | 134 | 1 | |
| β-strand | 142-145 | 4 | 15 |
| β-strand | 150-153 | 4 | 15 |
| β-strand | 159-161 | 3 | 14 |
| β-strand | 164 | 1 | 13 |
| α-helix | 168-170 | 3 | |
| β-strand | 173-181 | 9 | 15 |
| α-helix | 184-186 | 3 | |
| α-helix | 190-191 | 2 | |
| α-helix | 195-199 | 5 | |
| β-strand | 215-217 | 3 | 14 |
| β-strand | 224-227 | 4 | 15 |
| β-strand | 234-239 | 6 | 15 |
| α-helix | 242-244 | 3 | |
| β-strand | 252-256 | 5 | 14 |
| β-strand | 271-279 | 9 | 15 |
| β-strand | 288-294 | 7 | 15 |
| α-helix | 298-310 | 13 | |
Chain K: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 116-117 | 2 | |
| β-strand | 121 | 1 | 16 |
| β-strand | 128-130 | 3 | 17 |
| β-strand | 142-145 | 4 | 16 |
| β-strand | 150-153 | 4 | 16 |
| β-strand | 159-164 | 6 | 17 |
| β-strand | 174-181 | 8 | 16 |
| α-helix | 195-198 | 4 | |
| β-strand | 215-217 | 3 | 17 |
| β-strand | 224-227 | 4 | 16 |
| β-strand | 234-239 | 6 | 16 |
| α-helix | 242-244 | 3 | |
| β-strand | 250-256 | 7 | 17 |
| β-strand | 271-278 | 8 | 16 |
| β-strand | 284-294 | 11 | 16 |
| α-helix | 298-308 | 11 | |
Chain L: 2 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 121 | 1 | 18 |
| β-strand | 127-130 | 4 | 19 |
| β-strand | 142-145 | 4 | 18 |
| β-strand | 150-153 | 4 | 18 |
| β-strand | 159-165 | 7 | 19 |
| β-strand | 174-181 | 8 | 18 |
| β-strand | 190 | 1 | 18 |
| α-helix | 195-199 | 5 | |
| β-strand | 215-217 | 3 | 19 |
| β-strand | 224-227 | 4 | 18 |
| β-strand | 234-239 | 6 | 18 |
| β-strand | 250-256 | 7 | 19 |
| β-strand | 271-278 | 8 | 18 |
| β-strand | 284-294 | 11 | 18 |
| α-helix | 300-309 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tumor protein p73 | A, B, C, D, I, J, K, L | protein | 210 | Homo sapiens | O15350 (AlphaFold model) |
| DNA (5'-d(*cp*gp*gp*gp*cp*ap*ap*gp*cp*cp*cp*g)-3') | E, G, M, O | DNA | 12 | | |
| DNA (5'-d(*cp*gp*gp*gp*cp*tp*tp*gp*cp*cp*cp*g)-3') | F, H, N, P | DNA | 12 | | |
Sequence of entity 1 (A, B, C, D, I, J, K, L), FASTA
>4GUO_1 Tumor protein p73 (chains A, B, C, D, I, J, K, L)
MGHHHHHHHHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQ
IKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNL
SQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDG
QVLGRRSFEGRICACPGRDRKADEDHYREQ
Sequence of entity 2 (E, G, M, O), FASTA
>4GUO_2 DNA (5'-D(*CP*GP*GP*GP*CP*AP*AP*GP*CP*CP*CP*G)-3') (chains E, G, M, O)
CGGGCAAGCCCG
Sequence of entity 3 (F, H, N, P), FASTA
>4GUO_3 DNA (5'-D(*CP*GP*GP*GP*CP*TP*TP*GP*CP*CP*CP*G)-3') (chains F, H, N, P)
CGGGCTTGCCCG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 8 |
Primary citation
structure of p73 DNA binding domain complex with 12 bp DNA. S Ethayathulla, A., Viadiu, H. To be published.
Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
- 5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
- 2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
- 8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
- 9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
- 2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
- 2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
- 9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
- 8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
- 4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
- 2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
- 1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
Browse structure collections
About this viewer
MolViewer shows 4GUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.