4GUQ: MutS139F p73 DNA binding domain

Structure of mutS139F p73 DNA binding domain complexed with 20BP DNA response element. Determined by X-ray diffraction at 3.7 Å resolution. Released 14 Aug 2013.

Method: X-ray diffraction
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,533
Mol. weight: 53.89 kDa
Ligands: ZN
Released: 14 Aug 2013

Explore 4GUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GUQ contains 15 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	1
β-strand	127-130	4	2
α-helix	132-135	4
β-strand	144-145	2	1
β-strand	150-154	5	1
β-strand	159-165	7	2
α-helix	168-170	3
β-strand	174-181	8	1
α-helix	184-187	4
α-helix	190-191	2
α-helix	195-198	4
α-helix	201-204	4
β-strand	215-217	3	2
β-strand	224-227	4	1
β-strand	234-239	6	1
α-helix	242-244	3
β-strand	250-256	7	2
β-strand	263	1	3
β-strand	265	1	3
β-strand	271-278	8	1
β-strand	284-295	12	1
α-helix	298-310	13

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	128-130	3	4
α-helix	132-134	3
β-strand	142-145	4	5
β-strand	150-154	5	5
β-strand	159-164	6	4
β-strand	174-177	4	5
β-strand	179-181	3	5
α-helix	184-187	4
α-helix	190-191	2
α-helix	195-198	4
α-helix	201-204	4
β-strand	215-216	2	6
β-strand	224-227	4	5
β-strand	234-239	6	5
α-helix	242-244	3
β-strand	250-254	5	4
β-strand	255-256	2	6
β-strand	271-278	8	5
β-strand	284-295	12	5
α-helix	298-310	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(pgpapapcpaptpgptptpc)-3')	E, F	DNA	10
Tumor protein p73	A, B	protein	210	Homo sapiens	O15350 (AlphaFold model)

Sequence of entity 1 (E, F), FASTA

>4GUQ_1 DNA (5'-D(P*GP*AP*AP*CP*AP*TP*GP*TP*TP*C)-3') (chains E, F)
GAACATGTTC

Sequence of entity 2 (A, B), FASTA

>4GUQ_2 Tumor protein p73 (chains A, B)
MGHHHHHHHHEFIPSNTDYPGPHHFEVTFQQSSTAKFATWTYSPLLKKLYCQIAKTCPIQ
IKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNL
SQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDG
QVLGRRSFEGRICACPGRDRKADEDHYREQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Transactivation specificity is conserved among p53 family proteins and depends on a response element sequence code. Ciribilli, Y., Monti, P., Bisio, A. et al. Nucleic Acids Res (2013) 41:8637-8653. DOI 10.1093/nar/gkt657 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…

Browse structure collections

About this viewer

MolViewer shows 4GUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.