4H9S: Complex structure 6 of DAXX/H3.3(sub7)/H4
Complex structure 6 of DAXX/H3.3(sub7)/H4. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Oct 2012.
- Method
- X-ray diffraction
- Resolution
- 2.6 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 6,076
- Mol. weight
- 100.6 kDa
- Ligands
- PO4
- Released
- 17 Oct 2012
Explore 4H9S in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4H9S contains 36 α-helices and 10 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 48-57 | 10 | |
| α-helix | 64-78 | 15 | |
| β-strand | 83-85 | 3 | 1 |
| α-helix | 86-110 | 25 | |
| β-strand | 119 | 1 | 2 |
| α-helix | 121-131 | 11 | |
Chain B: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 45-47 | 3 | |
| α-helix | 48-57 | 10 | |
| α-helix | 64-77 | 14 | |
| β-strand | 83-85 | 3 | 3 |
| α-helix | 86-110 | 25 | |
| β-strand | 119 | 1 | 4 |
| α-helix | 121-131 | 11 | |
Chain C: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-40 | 10 | |
| β-strand | 46 | 1 | 2 |
| α-helix | 48-75 | 28 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-90 | 8 | |
| α-helix | 95-97 | 3 | |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 31-40 | 10 | |
| β-strand | 46 | 1 | 4 |
| α-helix | 49-75 | 27 | |
| β-strand | 80-81 | 2 | 3 |
| α-helix | 83-91 | 9 | |
| α-helix | 95-97 | 3 | |
Chain E: 9 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 185-207 | 23 | |
| β-strand | 209-210 | 2 | 3 |
| α-helix | 213-216 | 4 | |
| α-helix | 221-243 | 23 | |
| α-helix | 252-254 | 3 | |
| α-helix | 265-275 | 11 | |
| α-helix | 286-299 | 14 | |
| α-helix | 306-335 | 30 | |
| α-helix | 350-352 | 3 | |
| α-helix | 355-386 | 32 | |
Chain F: 10 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 185-207 | 23 | |
| β-strand | 209-210 | 2 | 1 |
| α-helix | 214-216 | 3 | |
| α-helix | 221-243 | 23 | |
| α-helix | 252-254 | 3 | |
| α-helix | 265-275 | 11 | |
| α-helix | 286-299 | 14 | |
| α-helix | 306-334 | 29 | |
| α-helix | 339-342 | 4 | |
| α-helix | 350-353 | 4 | |
| α-helix | 355-385 | 31 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3.3 | A, B | protein | 135 | Homo sapiens | P84243 (AlphaFold model) |
| Histone H4 | C, D | protein | 83 | Homo sapiens | P62805 (AlphaFold model) |
| Death domain-associated protein 6 | E, F | protein | 216 | Homo sapiens | Q9UER7 (AlphaFold model) |
Sequence of entity 1 (A, B), FASTA
>4H9S_1 Histone H3.3 (chains A, B)
ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREICQDFKTDLRWQSAAIGALQEAAEAFLVALFEDTNLCTIHAKRVTIF
PKDIQLARRIRGERA
Sequence of entity 2 (C, D), FASTA
>4H9S_2 Histone H4 (chains C, D)
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (E, F), FASTA
>4H9S_3 Death domain-associated protein 6 (chains E, F)
GSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCEL
KDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSL
GLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLR
ENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PO4 | Phosphate ion | O4 P | 5 |
Primary citation
DAXX chaperone envelops an H3.3/H4 dimer dictating H3.3-specific read out. Elsasser, S.J., Huang, H., Lewis, P.W. et al. To be published.
Other PDB entries of the same protein (UniProt P84243 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3QL9 0.93 Å, Monoclinic complex structure of ATRX ADD bound to histone H3K9me3 peptide
- 4GNE 1.47 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-7
- 4L58 1.48 Å, Crystal structure of the MLL5 PHD finger in complex with H3K4me3
- 5JLB 1.5 Å, Crystal structure of SETD2 bound to histone H3.3 K36I peptide
- 4GNF 1.55 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3 peptide 1-15
- 3QLA 1.6 Å, Hexagonal complex structure of ATRX ADD bound to H3K9me3 peptide
- 3MUL 1.65 Å, Crystal structure of Brd4 bromodomain 1 with butyrylated histone H3-K(buty)14
- 9G4A 1.65 Å, Structure of human SETD2 T1663M mutant in complex with SAM and H3K36M peptide
- 4GNG 1.73 Å, Crystal Structure of NSD3 tandem PHD5-C5HCH domains complexed with H3K9me3 peptide
- 3MUK 1.75 Å, Crystal structure of Brd4 bromodomain 1 with propionylated histone H3-K(prop)23
- 4QQ4 1.75 Å, CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3
- 1PDQ 1.76 Å, Polycomb chromodomain complexed with the histone H3 tail containing trimethyllysine 27.
Browse structure collections
About this viewer
MolViewer shows 4H9S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.