4HKD: Human MST2 SARAH domain

Crystal structure of human MST2 SARAH domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,990
Mol. weight: 26.24 kDa
Released: 4 Sept 2013

Explore 4HKD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4HKD contains 9 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	437-440	4
α-helix	445-483	39

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	433-441	9
α-helix	445-481	37

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	433-440	8
α-helix	445-481	37

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	433-435	3
α-helix	437-440	4
α-helix	445-483	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 3	A, B, C, D	protein	53	Homo sapiens	Q13188 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4HKD_1 Serine/threonine-protein kinase 3 (chains A, B, C, D)
GAMDDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK

Primary citation

Crystal structure of human MST2 SARAH domain. Liu, G.G., Shi, Z.B., Zhou, Z.C. To be published.

Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L0N 1.4 Å, Crystal structure of STK3 (MST2) SARAH domain
6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
4OH9 1.7 Å, Crystal Structure of the human MST2 SARAH homodimer
8A66 1.9 Å, Crystal structure of MST2 in complex with XMU-MP-1
3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
4LG4 2.42 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
6AO5 2.96 Å, Crystal structure of human MST2 in complex with SAV1 SARAH domain
4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5

Browse structure collections

About this viewer

MolViewer shows 4HKD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.