4JO9: Nucleoporin p54

Crystal structure of the human Nup49CCS2+3* Nup57CCS3* complex 1:2 stoichiometry. Determined by X-ray diffraction at 2.5 Å resolution. Released 17 Sept 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,355
Mol. weight: 19.65 kDa
Released: 17 Sept 2014

Explore 4JO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JO9 contains 6 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	460-493	34

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	330-358	29
α-helix	360-363	4
α-helix	368-410	43

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	460-472	13
α-helix	477-491	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin p54	A, C	protein	40	Homo sapiens	Q7Z3B4 (AlphaFold model)
Nucleoporin p58/p45	B	protein	87	Homo sapiens	Q9BVL2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4JO9_1 Nucleoporin p54 (chains A, C)
SYYIDADLLREIKQHLKQQQEGLSHLISIIKDDLEDIKLV

Sequence of entity 2 (B), FASTA

>4JO9_2 Nucleoporin p58/p45 (chains B)
SAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVAL
AAQLQSIHENVKVLKEQYLGYRKMFLG

Primary citation

Architecture of the fungal nuclear pore inner ring complex. Stuwe, T., Bley, C.J., Thierbach, K. et al. Science (2015) 350:56-64. DOI 10.1126/science.aac9176 · PubMed

Other PDB entries of the same protein (UniProt Q7Z3B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7N8R 1.2 Å, FGTGFG segment from the Nucleoporin p54, residues 63-68
4JNU 1.45 Å, Crystal structure of the human Nup57CCS3* coiled-coil segment, space group P21
4JO7 1.75 Å, Crystal structure of the human Nup49CCS2+3* Nup57CCS3* complex with 2:2 stoichiometry
4JNV 1.85 Å, Crystal structure of the human Nup57CCS3* coiled-coil segment, space group C2
7R5K 12.0 Å, Human nuclear pore complex (constricted)
5IJN 21.4 Å, Composite structure of the inner ring of the human nuclear pore complex (32 copies of…
5IJO 21.4 Å, Alternative composite structure of the inner ring of the human nuclear pore complex (16…
7PER 35.0 Å, Model of the inner ring of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 4JO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.