Crystal structure of Drosophila Cryprochrome. Determined by X-ray diffraction at 3.2 Å resolution. Released 26 Jun 2013.
Explore 4K03 in 3D Show helices and sheets RCSB PDB PDBe
4K03 contains 64 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-11 | 6 | 1 |
| α-helix | 21-25 | 5 | |
| α-helix | 34 | 1 | |
| β-strand | 35-42 | 8 | 1 |
| α-helix | 54-72 | 19 | |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 88-98 | 11 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 114-128 | 15 | |
| β-strand | 131-135 | 5 | 1 |
| α-helix | 143-149 | 7 | |
| β-strand | 157 | 1 | 2 |
| α-helix | 158-167 | 10 | |
| α-helix | 177-179 | 3 | |
| β-strand | 185 | 1 | 1 |
| α-helix | 190-196 | 7 | |
| α-helix | 205-208 | 4 | |
| α-helix | 226-246 | 21 | |
| α-helix | 267-271 | 5 | |
| α-helix | 277-288 | 12 | |
| β-strand | 296 | 1 | 3 |
| β-strand | 301 | 1 | 3 |
| α-helix | 303-305 | 3 | |
| α-helix | 306-321 | 16 | |
| α-helix | 347-355 | 9 | |
| α-helix | 361-373 | 13 | |
| α-helix | 378-388 | 11 | |
| α-helix | 398-407 | 10 | |
| α-helix | 413-425 | 13 | |
| α-helix | 430-433 | 4 | |
| α-helix | 435-438 | 4 | |
| α-helix | 444-447 | 4 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 472-474 | 3 | |
| α-helix | 477-482 | 6 | |
| β-strand | 487 | 1 | 4 |
| β-strand | 491 | 1 | 4 |
| α-helix | 498-514 | 17 | |
| α-helix | 519-520 | 2 | |
| β-strand | 524 | 1 | 2 |
| α-helix | 528-535 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -1-4 | 6 | |
| β-strand | 6-11 | 6 | 5 |
| β-strand | 18 | 1 | 6 |
| α-helix | 21-27 | 7 | |
| α-helix | 34 | 1 | |
| β-strand | 35-42 | 8 | 5 |
| α-helix | 54-74 | 21 | |
| β-strand | 82-85 | 4 | 5 |
| α-helix | 88-98 | 11 | |
| β-strand | 103-107 | 5 | 5 |
| α-helix | 112-114 | 3 | |
| α-helix | 115-128 | 14 | |
| β-strand | 131-135 | 5 | 5 |
| α-helix | 143-149 | 7 | |
| α-helix | 154-155 | 2 | |
| α-helix | 158-167 | 10 | |
| α-helix | 171-176 | 6 | |
| β-strand | 177 | 1 | 6 |
| α-helix | 178 | 1 | |
| α-helix | 190-195 | 6 | |
| β-strand | 198 | 1 | 5 |
| α-helix | 205-208 | 4 | |
| α-helix | 227-246 | 20 | |
| α-helix | 267-271 | 5 | |
| α-helix | 277-288 | 12 | |
| β-strand | 296 | 1 | 7 |
| β-strand | 301 | 1 | 7 |
| α-helix | 303-305 | 3 | |
| α-helix | 306-320 | 15 | |
| α-helix | 347-353 | 7 | |
| α-helix | 361-373 | 13 | |
| α-helix | 378-388 | 11 | |
| β-strand | 389 | 1 | 8 |
| β-strand | 394 | 1 | 8 |
| α-helix | 397-407 | 11 | |
| α-helix | 413-424 | 12 | |
| α-helix | 430-433 | 4 | |
| α-helix | 435-438 | 4 | |
| α-helix | 441-447 | 7 | |
| α-helix | 452-457 | 6 | |
| α-helix | 459-461 | 3 | |
| α-helix | 472-474 | 3 | |
| α-helix | 477-482 | 6 | |
| β-strand | 488 | 1 | 9 |
| β-strand | 491 | 1 | 9 |
| α-helix | 498-514 | 17 | |
| α-helix | 519-520 | 2 | |
| α-helix | 528-534 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A, B | protein | 561 | Drosophila melanogaster | O77059 (AlphaFold model) |
>4K03_1 Cryptochrome-1 (chains A, B) GAMGSGIQRPTSTSSLVAAMATRGANVIWFRHGLRLHDNPALLAALADKDQGIALIPVFI FDGESAGTKNVGYNRMRFLLDSLQDIDDQLQAATDGRGRLLVFEGEPAYIFRRLHEQVRL HRICIEQDCEPIWNERDESIRSLCRELNIDFVEKVSHTLWDPQLVIETNGGIPPLTYQMF LHTVQIIGLPPRPTADARLEDATFVELDPEFCRSLKLFEQLPTPEHFNVYGDNMGFLAKI NWRGGETQALLLLDERLKVEQHAFERGFYLPNQALPNIHDSPKSMSAHLRFGCLSVRRFY WSVHDLFKNVQLRACVRGVQMTGGAHITGQLIWREYFYTMSVNNPNYDRMEGNDICLSIP WAKPNENLLQSWRLGQTGFPLIDGAMRQLLAEGWLHHTLRNTVATFLTRGGLWQSWEHGL QHFLKYLLDADWSVCAGNWMWVSSSAFERLLDSSLVTCPVALAKRLDPDGTYIKQYVPEL MNVPKEFVHEPWRMSAEQQEQYECLIGVHYPERIIDLSMAVKRNMLAMKSLRNSLITPPP HCRPSNEEEVRQFFWLADVVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| FAD | Flavin-adenine dinucleotide | C27 H33 N9 O15 P2 | 2 |
Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function. Czarna, A., Berndt, A., Singh, H.R. et al. Cell (2013) 153:1394-1405. DOI 10.1016/j.cell.2013.05.011 · PubMed
Other PDB entries of the same protein (UniProt O77059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K03 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.