4K1O: AlphaN-catenin actin-binding domain

Crystal structure of the alphaN-catenin actin-binding domain. Determined by X-ray diffraction at 2.6 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,544
Mol. weight: 29.39 kDa
Released: 1 May 2013

Explore 4K1O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K1O contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	668-672	5
α-helix	677-702	26
α-helix	710-729	20
α-helix	738-763	26
α-helix	769-791	23
β-strand	798-802	5	1
β-strand	805-809	5	1
α-helix	811-846	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin alpha-2	A	protein	264	Mus musculus	Q61301 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4K1O_1 Catenin alpha-2 (chains A)
GSPEFPGRLSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEV
AKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARA
VADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAA
KNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRV
RRGSQKKHISPVQALSEFKAMDSF

Primary citation

An autoinhibited structure of alpha-catenin and its implications for vinculin recruitment to adherens junctions. Ishiyama, N., Tanaka, N., Abe, K. et al. J Biol Chem (2013) 288:15913-15925. DOI 10.1074/jbc.M113.453928 · PubMed

Other PDB entries of the same protein (UniProt Q61301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XFL 2.45 Å, Crystal structure of the force-sensing device region of alpha N-catenin
4P9T 2.5 Å, Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…
6DUY 2.81 Å, Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant

Browse structure collections

About this viewer

MolViewer shows 4K1O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.