6DUY: Alpha-N-catenin actin-binding domain H1 mutant

Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant. Determined by X-ray diffraction at 2.81 Å resolution. Released 19 Dec 2018.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,916
Mol. weight: 56.24 kDa
Released: 19 Dec 2018

Explore 6DUY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DUY contains 14 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	674-676	3
α-helix	677-702	26
α-helix	710-730	21
α-helix	738-765	28
α-helix	769-792	24
β-strand	798-802	5	1
β-strand	805-809	5	1
α-helix	813-846	34
α-helix	853-854	2

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	674-676	3
α-helix	677-703	27
α-helix	710-729	20
α-helix	738-765	28
α-helix	769-792	24
β-strand	798-802	5	2
β-strand	805-809	5	2
α-helix	813-846	34
α-helix	853-854	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin alpha-2	A, B	protein	257	Mus musculus	Q61301 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6DUY_1 Catenin alpha-2 (chains A, B)
GSSRTSVQTEDDQLIAGQSAGSGSAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSG
NDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPD
SACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAV
VLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKK
HISPVQALSEFKAMDSF

Primary citation

Force-dependent allostery of the alpha-catenin actin-binding domain controls adherens junction dynamics and functions. Ishiyama, N., Sarpal, R., Wood, M.N. et al. Nat Commun (2018) 9:5121-5121. DOI 10.1038/s41467-018-07481-7 · PubMed

Other PDB entries of the same protein (UniProt Q61301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XFL 2.45 Å, Crystal structure of the force-sensing device region of alpha N-catenin
4P9T 2.5 Å, Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin
4K1O 2.6 Å, Crystal structure of the alphaN-catenin actin-binding domain
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…

Browse structure collections

About this viewer

MolViewer shows 6DUY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.