5XFL: Force-sensing device region of alpha N-catenin

Crystal structure of the force-sensing device region of alpha N-catenin. Determined by X-ray diffraction at 2.45 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Mus musculus
Chains: 4
Atoms: 11,346
Mol. weight: 166.95 kDa
Released: 28 Mar 2018

Explore 5XFL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XFL contains 60 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	275-286	12
α-helix	296-319	24
α-helix	325-350	26
α-helix	360-391	32
α-helix	397-406	10
α-helix	411-437	27
α-helix	442-471	30
α-helix	476-502	27
α-helix	506-529	24
α-helix	533-558	26
α-helix	565-576	12
α-helix	577-581	5
α-helix	582-597	16
α-helix	607-627	21

Chain B: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	275-286	12
α-helix	291-293	3
α-helix	296-319	24
α-helix	325-350	26
α-helix	358-359	2
α-helix	360-391	32
α-helix	397-407	11
α-helix	411-437	27
α-helix	442-471	30
α-helix	476-502	27
α-helix	506-529	24
α-helix	533-558	26
α-helix	565-576	12
α-helix	577-581	5
α-helix	582-597	16
α-helix	607-628	22

Chain C: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	275-286	12
α-helix	296-319	24
α-helix	325-351	27
α-helix	361-391	31
α-helix	397-407	11
α-helix	411-437	27
α-helix	442-471	30
α-helix	476-501	26
α-helix	506-530	25
α-helix	533-557	25
α-helix	558-560	3
α-helix	565-576	12
α-helix	577-581	5
α-helix	582-597	16
α-helix	601-603	3
α-helix	606-627	22

Chain D: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	275-285	11
α-helix	296-319	24
α-helix	325-350	26
α-helix	362-391	30
α-helix	397-406	10
α-helix	411-437	27
α-helix	442-470	29
α-helix	476-502	27
α-helix	506-529	24
α-helix	533-558	26
α-helix	565-576	12
α-helix	577-581	5
α-helix	582-597	16
α-helix	606-628	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin alpha-2	A, B, C, D	protein	375	Mus musculus	Q61301 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5XFL_1 Catenin alpha-2 (chains A, B, C, D)
GPATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFRPSLEERLESIISGAALM
ADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLR
RQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACS
ISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLT
EAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAE
MENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVY
DGVRDIRKAVLMIRT

Primary citation

The force-sensing device region of alpha-catenin is an intrinsically disordered segment in the absence of intramolecular stabilization of the autoinhibitory form. Hirano, Y., Amano, Y., Yonemura, S. et al. Genes Cells (2018) 23:370-385. DOI 10.1111/gtc.12578 · PubMed

Other PDB entries of the same protein (UniProt Q61301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4P9T 2.5 Å, Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin
4K1O 2.6 Å, Crystal structure of the alphaN-catenin actin-binding domain
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…
6DUY 2.81 Å, Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant

Browse structure collections

About this viewer

MolViewer shows 5XFL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.