4P9T: Catenin alpha-2

Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin. Determined by X-ray diffraction at 2.5 Å resolution. Released 29 Apr 2015.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,731
Mol. weight: 119.34 kDa
Released: 29 Apr 2015

Explore 4P9T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P9T contains 28 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	22-39	18
α-helix	55-81	27
α-helix	86-112	27
α-helix	117-165	49
α-helix	169-196	28
α-helix	200-229	30
α-helix	234-258	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin alpha-2	A, B, C, D	protein	263	Mus musculus	Q61301 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4P9T_1 Catenin alpha-2 (chains A, B, C, D)
GPMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAH
VLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSV
KRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKE
FGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRA
NRDYVFKQVQEAIAGISSAAQAT

Primary citation

Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin. Shibahara, T., Hirano, Y., Hakoshima, T. FEBS Lett (2015) 589:1754-1760. DOI 10.1016/j.febslet.2015.05.053 · PubMed

Other PDB entries of the same protein (UniProt Q61301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XFL 2.45 Å, Crystal structure of the force-sensing device region of alpha N-catenin
4K1O 2.6 Å, Crystal structure of the alphaN-catenin actin-binding domain
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…
6DUY 2.81 Å, Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant

Browse structure collections

About this viewer

MolViewer shows 4P9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.