The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin. Determined by X-ray diffraction at 1.41 Å resolution. Released 28 May 2014.
Explore 4LNP in 3D Show helices and sheets RCSB PDB PDBe
4LNP contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 795 | 1 | |
| β-strand | 796-800 | 5 | 1 |
| β-strand | 804 | 1 | 2 |
| β-strand | 811 | 1 | 1 |
| β-strand | 814 | 1 | 2 |
| β-strand | 819-825 | 7 | 1 |
| β-strand | 830-835 | 6 | 1 |
| β-strand | 838-843 | 6 | 1 |
| α-helix | 844-846 | 3 | |
| β-strand | 847-849 | 3 | 1 |
| α-helix | 850-853 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 871-878 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sorbin and SH3 domain-containing protein 1 | A | protein | 61 | Homo sapiens | Q9BX66 (AlphaFold model) |
| Vinculin | B | protein | 10 | Homo sapiens | P18206 (AlphaFold model) |
>4LNP_1 Sorbin and SH3 domain-containing protein 1 (chains A) EMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPA E
>4LNP_2 Vinculin (chains B) VPPPRPPPPE
Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin. Zhao, D., Wang, X., Peng, J. et al. J Struct Biol (2014) 187:194-205. DOI 10.1016/j.jsb.2014.05.009 · PubMed
Other PDB entries of the same protein (UniProt Q9BX66 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4LNP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.