4LUQ: Virulence effector Tse3

Crystal structure of virulence effector Tse3 in complex with neutralizer Tsi3. Determined by X-ray diffraction at 1.77 Å resolution. Released 18 Sept 2013.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Pseudomonas aeruginosa
Chains: 4
Atoms: 8,997
Mol. weight: 125.37 kDa
Ligands: CA
Released: 18 Sept 2013

Explore 4LUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LUQ contains 69 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
α-helix	23-34	12
α-helix	39-49	11
α-helix	51-58	8
α-helix	62-75	14
α-helix	80-90	11
α-helix	91-93	3
α-helix	101-103	3
α-helix	108-125	18
α-helix	147-150	4
α-helix	154-156	3
α-helix	158-161	4
α-helix	162-170	9
α-helix	173-178	6
α-helix	186-191	6
α-helix	195-207	13
β-strand	209	1	1
α-helix	210	1
α-helix	215-217	3
α-helix	222-223	2
β-strand	224	1	1
α-helix	225-235	11
α-helix	240-252	13
α-helix	256-267	12
β-strand	275-276	2	2
β-strand	281-282	2	2
α-helix	283-288	6
α-helix	298-302	5
α-helix	306-313	8
α-helix	316-335	20
α-helix	339-341	3
α-helix	343-348	6
α-helix	355-358	4
α-helix	361-363	3
α-helix	366-377	12
α-helix	389-400	12

Chain B: 32 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
α-helix	23-34	12
α-helix	39-49	11
α-helix	51-58	8
α-helix	62-75	14
α-helix	80-90	11
α-helix	91-93	3
α-helix	101-103	3
α-helix	108-125	18
α-helix	147-150	4
α-helix	154-156	3
α-helix	158-161	4
α-helix	162-169	8
α-helix	173-178	6
α-helix	186-191	6
α-helix	195-207	13
β-strand	209	1	3
α-helix	210	1
α-helix	215-217	3
α-helix	222-223	2
β-strand	224	1	3
α-helix	225-235	11
α-helix	240-252	13
α-helix	256-267	12
β-strand	275-276	2	4
β-strand	281-282	2	4
α-helix	283-288	6
α-helix	298-302	5
α-helix	306-313	8
α-helix	316-335	20
α-helix	339-341	3
α-helix	343-348	6
α-helix	355-358	4
α-helix	361-363	3
α-helix	366-377	12
α-helix	389-400	12

Chain C: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	24-29	6	5
β-strand	34-39	6	5
β-strand	42-46	5	6
β-strand	50-55	6	6
β-strand	64-70	7	6
α-helix	73-75	3
β-strand	79-83	5	6
β-strand	86-98	13	6
β-strand	101-112	12	6
β-strand	115-125	11	6
α-helix	133-141	9
β-strand	143-144	2	5

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	7
β-strand	34-39	6	7
β-strand	42-46	5	8
β-strand	50-55	6	8
β-strand	64-70	7	8
α-helix	73-75	3
β-strand	79-83	5	8
β-strand	86-98	13	8
β-strand	101-112	12	8
β-strand	115-125	11	8
α-helix	133-141	9
β-strand	143-144	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein	A, B	protein	428	Pseudomonas aeruginosa	Q9HYC5 (AlphaFold model)
Uncharacterized protein	C, D	protein	144	Pseudomonas aeruginosa	Q9HYC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LUQ_1 Uncharacterized protein (chains A, B)
MGSSHHHHHHSSGLVPRGSHMTATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPD
ATIAALDKSGSLIKLFQRVGPPELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQT
DNWIYFPTITFFDICADLADAAGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSI
AFGDQLKLLNKDPATVTKYSNPLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPG
NPPSRAKVMSAAARKYDLTPQLIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQ
VVVSTAIKYELFTDLLGQPVRRGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLR
KLPKTRGAFPSIDLRAYAGNPRNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATF
LDPGMRFP

Sequence of entity 2 (C, D), FASTA

>4LUQ_2 Uncharacterized protein (chains C, D)
MGSSHHHHHHSSGLVPRGSHMDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRN
PRQLEVQRQDAPPPPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSA
SEQSEDGEPTFALAWALLERARLQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Structural Insights on the Bacteriolytic and Self-protection Mechanism of Muramidase Effector Tse3 in Pseudomonas aeruginosa. Li, L., Zhang, W., Liu, Q. et al. J Biol Chem (2013) 288:30607-30613. DOI 10.1074/jbc.C113.506097 · PubMed

Other PDB entries of the same protein (UniProt Q9HYC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5E 1.49 Å, Tse3 structure
3WA5 1.9 Å, Crystal Structure of type VI peptidoglycan muramidase effector Tse3 in complex with its…
4N7S 2.1 Å, Crystal structure of Tse3-Tsi3 complex with Zinc ion
4N80 2.4 Å, Crystal structure of Tse3-Tsi3 complex
4M5F 2.5 Å, complex structure of Tse3-Tsi3
4N88 2.8 Å, Crystal structure of Tse3-Tsi3 complex with calcium ion

Browse structure collections

About this viewer

MolViewer shows 4LUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.