4N7S: Tse3-Tsi3 complex with Zinc ion

Crystal structure of Tse3-Tsi3 complex with Zinc ion. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Apr 2014.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Pseudomonas aeruginosa
Chains: 4
Atoms: 8,662
Mol. weight: 121.03 kDa
Ligands: ZN, CA
Released: 23 Apr 2014

Explore 4N7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N7S contains 68 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	15	1	1
β-strand	18	1	1
α-helix	23-34	12
α-helix	39-49	11
α-helix	52-58	7
α-helix	62-75	14
α-helix	80-91	12
α-helix	101-103	3
α-helix	108-125	18
α-helix	147-150	4
α-helix	154-156	3
α-helix	158-161	4
α-helix	162-169	8
α-helix	173-178	6
α-helix	186-190	5
α-helix	195-207	13
β-strand	209	1	2
α-helix	210	1
α-helix	215-217	3
α-helix	222-223	2
β-strand	224	1	2
α-helix	225-236	12
α-helix	240-252	13
α-helix	256-267	12
β-strand	275-276	2	3
β-strand	281-282	2	3
α-helix	283-288	6
α-helix	298-303	6
α-helix	306-313	8
α-helix	316-334	19
α-helix	339-341	3
α-helix	343-348	6
α-helix	355-358	4
α-helix	361-363	3
α-helix	366-377	12
α-helix	389-401	13

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	27-29	3	4
β-strand	35-37	3	4
α-helix	38-39	2
β-strand	42-46	5	5
β-strand	50-55	6	5
β-strand	64-70	7	5
α-helix	73-75	3
β-strand	79-83	5	5
β-strand	86-98	13	5
β-strand	101-112	12	5
β-strand	115-125	11	5
α-helix	133-141	9
β-strand	143	1	4

Chain C: 31 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	23-35	13
α-helix	39-48	10
α-helix	52-58	7
α-helix	62-75	14
α-helix	80-93	14
α-helix	101-103	3
α-helix	108-125	18
α-helix	147-150	4
α-helix	154-156	3
α-helix	158-161	4
α-helix	162-169	8
α-helix	173-179	7
α-helix	186-191	6
α-helix	195-207	13
β-strand	209	1	6
α-helix	210	1
α-helix	215-217	3
α-helix	222-223	2
β-strand	224	1	6
α-helix	225-236	12
α-helix	240-252	13
α-helix	256-267	12
β-strand	275-276	2	7
β-strand	281-282	2	7
α-helix	283-288	6
α-helix	298-303	6
α-helix	306-313	8
α-helix	316-334	19
α-helix	339-341	3
α-helix	343-348	6
α-helix	356-358	3
α-helix	361-363	3
α-helix	366-377	12
α-helix	389-401	13

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	8
α-helix	37-39	3
β-strand	42-43	2	9
β-strand	46	1	9
β-strand	50-55	6	9
β-strand	64-70	7	9
α-helix	73-75	3
β-strand	79-83	5	9
β-strand	86-98	13	9
β-strand	101-112	12	9
β-strand	115-125	11	9
α-helix	133-140	8
β-strand	143-144	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein	A, C	protein	401	Pseudomonas aeruginosa	Q9HYC5 (AlphaFold model)
inhibitor	B, D	protein	143	Pseudomonas aeruginosa	Q9HYC4 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4N7S_1 Uncharacterized protein (chains A, C)
TATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGP
PELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADA
AGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSN
PLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTPQ
LIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPVR
RGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGNP
RNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATFLD

Sequence of entity 2 (B, D), FASTA

>4N7S_2 inhibitor (chains B, D)
MGSSHHHHHHSSGENLYFQSHMSMTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNP
RQLEVQRQDAPPPPDLASRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSAS
EQSEDGEPTFALAWALLERARLQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	7
CA	Calcium ion	Ca	2

Water and common crystallization additives (CL, ACT, GOL, NA) are not listed.

Primary citation

Structural insights into the T6SS effector protein Tse3 and the Tse3-Tsi3 complex from Pseudomonas aeruginosa reveal a calcium-dependent membrane-binding mechanism. Lu, D., Shang, G., Zhang, H. et al. Mol Microbiol (2014) 92:1092-1112. DOI 10.1111/mmi.12616 · PubMed

Other PDB entries of the same protein (UniProt Q9HYC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5E 1.49 Å, Tse3 structure
4LUQ 1.77 Å, Crystal structure of virulence effector Tse3 in complex with neutralizer Tsi3
3WA5 1.9 Å, Crystal Structure of type VI peptidoglycan muramidase effector Tse3 in complex with its…
4N80 2.4 Å, Crystal structure of Tse3-Tsi3 complex
4M5F 2.5 Å, complex structure of Tse3-Tsi3
4N88 2.8 Å, Crystal structure of Tse3-Tsi3 complex with calcium ion

Browse structure collections

About this viewer

MolViewer shows 4N7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.