Crystal structure of Tse3-Tsi3 complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Apr 2014.
Explore 4N80 in 3D Show helices and sheets RCSB PDB PDBe
4N80 contains 34 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 | |
| α-helix | 19-35 | 17 | |
| α-helix | 39-49 | 11 | |
| α-helix | 51-58 | 8 | |
| α-helix | 62-75 | 14 | |
| α-helix | 80-91 | 12 | |
| α-helix | 101-103 | 3 | |
| α-helix | 108-125 | 18 | |
| α-helix | 130-132 | 3 | |
| α-helix | 147-150 | 4 | |
| α-helix | 154-156 | 3 | |
| α-helix | 158-161 | 4 | |
| α-helix | 162-169 | 8 | |
| α-helix | 173-178 | 6 | |
| α-helix | 186-191 | 6 | |
| α-helix | 195-207 | 13 | |
| β-strand | 209 | 1 | 1 |
| α-helix | 210 | 1 | |
| α-helix | 215-217 | 3 | |
| α-helix | 222-223 | 2 | |
| β-strand | 224 | 1 | 1 |
| α-helix | 225-236 | 12 | |
| α-helix | 240-252 | 13 | |
| α-helix | 256-267 | 12 | |
| β-strand | 275-276 | 2 | 2 |
| β-strand | 281-282 | 2 | 2 |
| α-helix | 283-288 | 6 | |
| α-helix | 298-303 | 6 | |
| α-helix | 306-312 | 7 | |
| α-helix | 316-335 | 20 | |
| α-helix | 339-341 | 3 | |
| α-helix | 343-348 | 6 | |
| α-helix | 354-357 | 4 | |
| α-helix | 361-363 | 3 | |
| α-helix | 366-377 | 12 | |
| α-helix | 389-399 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-29 | 6 | 3 |
| β-strand | 35-39 | 5 | 3 |
| β-strand | 42-46 | 5 | 4 |
| β-strand | 50-55 | 6 | 4 |
| β-strand | 64-70 | 7 | 4 |
| α-helix | 73-75 | 3 | |
| β-strand | 79-81 | 3 | 4 |
| β-strand | 88-98 | 11 | 4 |
| β-strand | 101-112 | 12 | 4 |
| β-strand | 115-125 | 11 | 4 |
| α-helix | 133-140 | 8 | |
| β-strand | 143 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uncharacterized protein | A | protein | 399 | Pseudomonas aeruginosa | Q9HYC5 (AlphaFold model) |
| Uncharacterized protein | B | protein | 125 | Pseudomonas aeruginosa | Q9HYC4 (AlphaFold model) |
>4N80_1 Uncharacterized protein (chains A) TATSDLIESLISYSWDDWQVTRQEARRVIAAIRNDNVPDATIAALDKSGSLIKLFQRVGP PELARSLIASIAGRTTMQRYQARNALIRSLINNPLGTQTDNWIYFPTITFFDICADLADA AGRLGFAAAGATGVASQAIQGPFSGVGATGVNPTDLPSIAFGDQLKLLNKDPATVTKYSN PLGDLGAYLSQLSPQDKLNQAQTLVGQPISTLFPDAYPGNPPSRAKVMSAAARKYDLTPQ LIGAIILAEQRDQTRDEDAKDYQAAVSIKSANTSIGLGQVVVSTAIKYELFTDLLGQPVR RGLSRKAVATLLASDEFNIFATARYIRYVANLASQQDLRKLPKTRGAFPSIDLRAYAGNP RNWPRDNVRALASEYTSRPWDDNLSPGWPMFVDDAYATF
>4N80_2 Uncharacterized protein (chains B) SHMDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLRNPRQLEVQRQDAPPPPDLA SRRLGDGEARYKVEEDDGGSAGSEYRLWAAKPAGARWIVVSASEQSEDGEPTFALAWALL ERARL
Structural insights into the T6SS effector protein Tse3 and the Tse3-Tsi3 complex from Pseudomonas aeruginosa reveal a calcium-dependent membrane-binding mechanism. Lu, D., Shang, G., Zhang, H. et al. Mol Microbiol (2014) 92:1092-1112. DOI 10.1111/mmi.12616 · PubMed
Other PDB entries of the same protein (UniProt Q9HYC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N80 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.