4LXO: 9,10Fn3-elegantin chimera

Crystal structure of 9,10Fn3-elegantin chimera. Determined by X-ray diffraction at 1.42 Å resolution. Released 6 Aug 2014.

Method: X-ray diffraction
Resolution: 1.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,334
Mol. weight: 42.1 kDa
Ligands: CA
Released: 6 Aug 2014

Explore 4LXO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LXO contains 16 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1327-1330	4
β-strand	1331-1336	6	1
β-strand	1343-1348	6	1
β-strand	1356-1363	8	2
α-helix	1369-1370	2
β-strand	1371-1375	5	2
β-strand	1381-1384	4	1
α-helix	1387-1388	2
β-strand	1392-1401	10	2
β-strand	1404-1405	2	2
α-helix	1406-1408	3
β-strand	1409-1414	6	2
α-helix	1415-1417	3
β-strand	1421-1429	9	3
β-strand	1432-1438	7	3
β-strand	1446-1453	8	4
α-helix	1459-1460	2
β-strand	1461-1466	6	4
β-strand	1471-1474	4	3
α-helix	1477-1478	2
β-strand	1482-1491	10	4
β-strand	1498-1499	2	4
α-helix	1500-1502	3
β-strand	1503-1508	6	4

Chain B: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	1327-1330	4
β-strand	1331-1336	6	5
β-strand	1343-1348	6	5
β-strand	1356-1363	8	6
α-helix	1369-1370	2
β-strand	1371-1376	6	6
β-strand	1381-1384	4	5
α-helix	1387-1388	2
β-strand	1392-1401	10	6
β-strand	1404-1405	2	6
α-helix	1406-1408	3
β-strand	1409-1414	6	6
α-helix	1415-1417	3
β-strand	1421-1429	9	7
β-strand	1432-1438	7	7
β-strand	1446-1453	8	8
α-helix	1458-1460	3
β-strand	1461-1466	6	8
β-strand	1471-1474	4	7
α-helix	1477-1478	2
β-strand	1483-1490	8	8
β-strand	1499	1	8
α-helix	1500-1502	3
β-strand	1503-1507	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A, B	protein	191	Homo sapiens	P02751 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4LXO_1 Fibronectin (chains A, B)
MHHHHHHGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPPLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYACRARGDNPD
CSKPISINYRT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Design, Structure Determination, and Biological Evaluation of Potent Integrin Alpha5beta1-Specific Antagonist Using the Ninth and Tenth Module of Fibronectin Type III Domain. Chang, Y.S., Shiu, J.H., Chuang, W.J. To be published.

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
1FNF 2.0 Å, Fragment of human fibronectin encompassing type-III repeats 7 through 10

Browse structure collections

About this viewer

MolViewer shows 4LXO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.