4M9I: NS2B-NS3 protease

A125C NS2B-NS3 protease from dengue virus at pH 5.5. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Nov 2013.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Dengue virus 2
Chains: 1
Atoms: 1,574
Mol. weight: 26.36 kDa
Released: 27 Nov 2013

Explore 4M9I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4M9I contains 6 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	51-57	7	1
α-helix	63-68	6
β-strand	70-72	3	2
β-strand	1021-1029	9	1
β-strand	1032-1042	11	1
β-strand	1045-1048	4	1
α-helix	1050-1053	4
α-helix	1056-1057	2
β-strand	1058-1060	3	1
β-strand	1063-1065	3	1
β-strand	1067-1071	5	1
α-helix	1072-1074	3
β-strand	1076-1079	4	1
β-strand	1095-1099	5	2
β-strand	1107-1111	5	2
α-helix	1113	1
β-strand	1114-1118	5	3
β-strand	1121-1126	6	3
α-helix	1132-1134	3
β-strand	1138-1140	3	2
β-strand	1146-1149	4	2
β-strand	1153-1155	3	3
β-strand	1161-1169	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NS2B-NS3 protease	A	protein	247	Dengue virus 2	P12823

Sequence of entity 1 (A), FASTA

>4M9I_1 NS2B-NS3 protease (chains A)
GSHMLEADLELERAADVRWEEQAEISGSSPILSITISEDGSMSIKNEEEEQTLGGGGSGG
GGAGVLWDVPSPPPVGKAELEDGAYRIKQKGILGYSQIGAGVYKEGTFHTMWHVTRGAVL
MHKGKRIEPSWADVKKDLISYGGGWKLEGEWKEGEEVQVLALEPGKNPRAVQTKPGLFKT
NTGTIGCVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVTRSGAYVSAIANTEKSIEDNPEI
EDDIFRK

Primary citation

Allosteric Inhibition of the NS2B-NS3 Protease from Dengue Virus. Yildiz, M., Ghosh, S., Bell, J.A. et al. ACS Chem Biol (2013) 8:2744-2752. DOI 10.1021/cb400612h · PubMed

Other PDB entries of the same protein (UniProt P12823), best resolution first:

4M9K 1.46 Å, NS2B-NS3 protease from dengue virus at pH 5.5
4M9M 1.53 Å, NS2B-NS3 protease from dengue virus at pH 8.5
4M9T 1.74 Å, NS2B-NS3 protease from dengue virus in the presence of DTNB, a covalent allosteric…
2P41 1.8 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG2'OMe and…
1OK8 2.0 Å, Crystal structure of the dengue 2 virus envelope glycoprotein in the postfusion…
2P3L 2.2 Å, Crystal Structure of Dengue Methyltransferase in Complex with GpppA and…
5HHG 2.2 Å, Mouse importin alpha: Dengue 2 NS5 C-terminal NLS peptide complex
1L9K 2.4 Å, dengue methyltransferase
1OKE 2.4 Å, Crystal structure of the dengue 2 virus envelope protein in complex with…
1R6A 2.6 Å, Structure of the dengue virus 2'O methyltransferase in complex with s-adenosyl…
4M9F 2.7 Å, Dengue virus NS2B-NS3 protease A125C variant at pH 8.5
2P40 2.7 Å, Crystal Structure of Dengue Methyltransferase in Complex with 7MeGpppG

Browse structure collections

About this viewer

MolViewer shows 4M9I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.