Crystal Structure of MTIP from Plasmodium falciparum in complex with pGly[801,805], a stapled myoA tail peptide. Determined by X-ray diffraction at 1.47 Å resolution. Released 6 Nov 2013.
Explore 4MZJ in 3D Show helices and sheets RCSB PDB PDBe
4MZJ contains 11 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-71 | 7 | |
| α-helix | 74-84 | 11 | |
| β-strand | 86 | 1 | 1 |
| β-strand | 89 | 1 | 1 |
| β-strand | 90-91 | 2 | 2 |
| α-helix | 92-101 | 10 | |
| α-helix | 108-118 | 11 | |
| β-strand | 121-122 | 2 | 2 |
| α-helix | 124-133 | 10 | |
| α-helix | 141-151 | 11 | |
| β-strand | 158-160 | 3 | 3 |
| α-helix | 161-170 | 10 | |
| α-helix | 174-176 | 3 | |
| α-helix | 177-187 | 11 | |
| β-strand | 192-194 | 3 | 3 |
| α-helix | 195-202 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 801-815 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin A tail domain interacting protein | A | protein | 145 | Plasmodium falciparum | Q8I4W8 (AlphaFold model) |
| Myosin-A | T | protein | 19 | Plasmodium falciparum | Q8IDR3 (AlphaFold model) |
>4MZJ_1 Myosin A tail domain interacting protein (chains A) GSVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKELYG DNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTDQE AIDALNAFSSEDNIDYKLFCEDILQ
>4MZJ_2 Myosin-A (chains T) XKNLPSLLRVQAHIRKKMV
Crystal Structures of Stapled and Hydrogen Bond Surrogate Peptides Targeting a Fully Buried Protein-Helix Interaction. Douse, C.H., Maas, S.J., Thomas, J.C. et al. ACS Chem Biol (2014) 8:506-512. DOI 10.1021/cb500271c · PubMed
Other PDB entries of the same protein (UniProt Q8I4W8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4MZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.