4N7F: 3rd WW domain of human Nedd4-1

Crystal structure of 3rd WW domain of human Nedd4-1. Determined by X-ray diffraction at 1.1 Å resolution. Released 8 Jan 2014.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 732
Mol. weight: 8.89 kDa
Released: 8 Jan 2014

Explore 4N7F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N7F contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	423-424	2
β-strand	427-431	5	1
β-strand	437-441	5	1
β-strand	446-448	3	1

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	422-424	3
β-strand	427-431	5	2
β-strand	437-441	5	2
β-strand	446-448	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase NEDD4	A, B	protein	38	Homo sapiens	P46934 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4N7F_1 E3 ubiquitin-protein ligase NEDD4 (chains A, B)
AMGSFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLK

Primary citation

Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3). Qi, S., O'Hayre, M., Gutkind, J.S. et al. J Biol Chem (2014) 289:4743-4752. DOI 10.1074/jbc.M113.527473 · PubMed

Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N7H 1.7 Å, Crystal Structure of the Complex of 3rd WW domain of Human Nedd4 and 1st PPXY Motif of…
3B7Y 1.8 Å, Crystal structure of the C2 Domain of the E3 Ubiquitin-Protein Ligase NEDD4
9H9O 2.12 Å, Crystal structure of NEDD4 HECT domain in complex with norclomipramine
9H9T 2.17 Å, Crystal structure of NEDD4 HECT domain in complex with covalent inhibitor
5C91 2.44 Å, NEDD4 HECT with covalently bound indole-based inhibitor
2XBF 2.5 Å, Nedd4 HECT structure
4BBN 2.51 Å, NEDD4 HECT-Ub:Ub complex
2XBB 2.68 Å, Nedd4 HECT:Ub complex
4BE8 3.0 Å, NEDD4 HECT A889F structure
5C7J 3.0 Å, Crystal structure of NEDD4 with a ub variant
2KPZ Human NEDD4 3RD WW Domain Complex with The Human T-cell Leukemia virus 1 GAG-Pro…
2KQ0 Human NEDD4 3rd WW Domain Complex with Ebola Zaire Virus Matrix Protein VP40 Derived…

Browse structure collections

About this viewer

MolViewer shows 4N7F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.