High-resolution structure of C domain of staphylococcal protein A at room temperature. Determined by X-ray diffraction at 1.42 Å resolution. Released 8 Oct 2014.
Explore 4NPE in 3D Show helices and sheets RCSB PDB PDBe
4NPE contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-18 | 12 | |
| α-helix | 24-36 | 13 | |
| α-helix | 38-40 | 3 | |
| α-helix | 41-54 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin G-binding protein A | A | protein | 58 | Staphylococcus aureus | P38507 (AlphaFold model) |
>4NPE_1 Immunoglobulin G-binding protein A (chains A) ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity. Deis, L.N., Pemble, C.W., Qi, Y. et al. Structure (2014) 22:1467-1477. DOI 10.1016/j.str.2014.08.014 · PubMed
Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4NPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.