5H76: DARPin-Protein A fusion protein

Crystal structure of the DARPin-Protein A fusion protein. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: synthetic construct, Staphylococcus aureus
Chains: 3
Atoms: 4,664
Mol. weight: 65.32 kDa
Released: 28 Jun 2017

Explore 5H76 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H76 contains 39 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	14-24	11
α-helix	27-35	9
α-helix	50-57	8
α-helix	60-68	9
α-helix	83-89	7
α-helix	93-101	9
α-helix	116-122	7
α-helix	126-134	9
α-helix	148-154	7
α-helix	158-170	13
α-helix	177-189	13
α-helix	191-193	3
α-helix	194-207	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DARPin,Immunoglobulin G-binding protein A	A, B, C	protein	201	synthetic construct, Staphylococcus aureus	P38507 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>5H76_1 DARPin,Immunoglobulin G-binding protein A (chains A, B, C)
GSHMDLGRKLLEAARAGQDDEVRILMANGADVNAADNTGTTPLHLAAYSGHLEIVEVLLK
HGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEI
VEVLLKHGAVNAQDKFGKTAFDISIDNGNEDLAQILAFYEILHLPNLNEEQRNAFIQSLK
DDPSQSANLLAEAKKLNDAQA

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H79 2.7 Å, Crystal structure of a repeat protein with three Protein A repeat module

Browse structure collections

About this viewer

MolViewer shows 5H76 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.