4NPF: Immunoglobulin G-binding protein A

High-resolution structure of two tandem B domains of staphylococcal protein A connected by the conserved linker. Determined by X-ray diffraction at 1.49 Å resolution. Released 8 Oct 2014.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 3,621
Mol. weight: 26.55 kDa
Released: 8 Oct 2014

Explore 4NPF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NPF contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-17	11
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-54	14
α-helix	57-102	4
α-helix	107-118	12
α-helix	124-136	13
α-helix	138-140	3
α-helix	141-154	14

Chain Y: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-18	12
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-54	14
α-helix	57-102	4
α-helix	107-117	11
α-helix	124-136	13
α-helix	138-140	3
α-helix	141-154	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein A	X, Y	protein	116	Staphylococcus aureus	P38507 (AlphaFold model)

Sequence of entity 1 (X, Y), FASTA

>4NPF_1 Immunoglobulin G-binding protein A (chains X, Y)
ADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKAD
NKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Primary citation

Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity. Deis, L.N., Pemble, C.W., Qi, Y. et al. Structure (2014) 22:1467-1477. DOI 10.1016/j.str.2014.08.014 · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein
5H79 2.7 Å, Crystal structure of a repeat protein with three Protein A repeat module

Browse structure collections

About this viewer

MolViewer shows 4NPF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.