4ZMD: Immunoglobulin G-binding protein A

C domain of staphylococcal protein A mutant - Q9W. Determined by X-ray diffraction at 1.87 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 943
Mol. weight: 13.39 kDa
Released: 15 Jul 2015

Explore 4ZMD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZMD contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-17	11
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-53	13

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-18	15
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-54	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein A	A, B	protein	58	Staphylococcus aureus	P38507 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4ZMD_1 Immunoglobulin G-binding protein A (chains A, B)
ADNKFNKEWQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK

Primary citation

Suppression of conformational heterogeneity at a protein-protein interface. Deis, L.N., Wu, Q., Wang, Y. et al. Proc Natl Acad Sci U S A (2015) 112:9028-9033. DOI 10.1073/pnas.1424724112 · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein
5H79 2.7 Å, Crystal structure of a repeat protein with three Protein A repeat module

Browse structure collections

About this viewer

MolViewer shows 4ZMD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.