4OH9: Human MST2 SARAH homodimer

Crystal Structure of the human MST2 SARAH homodimer. Determined by X-ray diffraction at 1.7 Å resolution. Released 23 Jul 2014.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 953
Mol. weight: 12.19 kDa
Released: 23 Jul 2014

Explore 4OH9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OH9 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	12-50	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 3	A, B	protein	51	Homo sapiens	Q13188 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OH9_1 Serine/threonine-protein kinase 3 (chains A, B)
GSDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAK

Primary citation

Structural basis of the heterodimerization of the MST and RASSF SARAH domains in the Hippo signalling pathway. Hwang, E., Cheong, H.K., Mushtaq, A.U. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:1944-1953. DOI 10.1107/S139900471400947X · PubMed

Other PDB entries of the same protein (UniProt Q13188 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L0N 1.4 Å, Crystal structure of STK3 (MST2) SARAH domain
4HKD 1.5 Å, Crystal structure of human MST2 SARAH domain
6AR2 1.55 Å, Structure of human SLMAP FHA domain in complex with pMST2
8A66 1.9 Å, Crystal structure of MST2 in complex with XMU-MP-1
3WWS 2.01 Å, Crystal structure of Serine/threonine-protein kinase 3
4LG4 2.42 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5
5DH3 2.47 Å, Crystal structure of MST2 in complex with XMU-MP-1
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…
6AO5 2.96 Å, Crystal structure of human MST2 in complex with SAV1 SARAH domain
4LGD 3.05 Å, Structural Basis for Autoactivation of Human Mst2 Kinase and Its Regulation by RASSF5

Browse structure collections

About this viewer

MolViewer shows 4OH9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.