4OWX: SOSS1

Structural basis of SOSS1 in complex with a 12nt ssDNA. Determined by X-ray diffraction at 2.3 Å resolution. Released 16 Apr 2014.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,906
Mol. weight: 82.03 kDa
Released: 16 Apr 2014

Explore 4OWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OWX contains 37 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	37	1	1
β-strand	43	1	2
α-helix	44-46	3
α-helix	47-63	17
α-helix	68-80	13
α-helix	83-99	17
α-helix	104-114	11
α-helix	120-132	13
α-helix	134-136	3
β-strand	137	1	1
α-helix	139-154	16
α-helix	160-168	9
α-helix	178-193	16
α-helix	195-198	4
α-helix	202-216	15
α-helix	223-242	20
α-helix	244-247	4
α-helix	248-250	3
α-helix	253-259	7
α-helix	265-276	12
α-helix	278-280	3
α-helix	288-292	5
α-helix	295-297	3
α-helix	298-303	6
α-helix	307-316	10
β-strand	321	1	3
α-helix	326-336	11
α-helix	340-344	5
α-helix	345-355	11
α-helix	361-364	4
β-strand	368	1	3
α-helix	371-380	10
α-helix	385-396	12
α-helix	409-411	3
α-helix	413-421	9
α-helix	427-443	17
α-helix	446-448	3
α-helix	449-465	17
α-helix	473-475	3
α-helix	483-492	10

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	17-26	10	2
β-strand	30-31	2	2
β-strand	37-45	9	2
β-strand	48-55	8	2
α-helix	58-61	4
β-strand	66-78	13	2
β-strand	81-97	17	2
β-strand	107	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(ptptptptptptptptp*t)-3')	L	DNA	12	Homo sapiens
Integrator complex subunit 3	A	protein	500	Homo sapiens	Q68E01 (AlphaFold model)
SOSS complex subunit B1	B	protein	211	Homo sapiens	Q9BQ15 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4OWX_1 DNA (5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*T)-3') (chains L)
TTTTTTTTTTTT

Sequence of entity 2 (A), FASTA

>4OWX_2 Integrator complex subunit 3 (chains A)
MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEERLERCMSIVT
SMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILTEPAQAQKCYRDLALVSRDGMN
IVLNKINQILMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVCMTFMKQIAGGDVTAKN
IWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQALRQKEVDFCISLL
RERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQSRTSRKF
LACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPS
NEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVMH
HSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPK
LDKELRAMLREKFPEFCSSP

Sequence of entity 3 (B), FASTA

>4OWX_3 SOSS complex subunit B1 (chains B)
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQA
PNKAVQNDSNPSASQPTTGPSAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRIT
RSQPNHTPAGPPGPSSNPVSNGKETRRSSKR

Primary citation

Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA. Ren, W., Chen, H., Sun, Q. et al. Cell Rep (2014) 6:982-991. DOI 10.1016/j.celrep.2014.02.020 · PubMed

Other PDB entries of the same protein (UniProt Q68E01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
7BV7 2.4 Å, INTS3 complexed with INTS6
8HPP 3.0 Å, Crystal structure of human INTS3 with SAGE1
6WLG 3.11 Å, Ints3 C-terminal Domain
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 4OWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.