4OY4: Calcium-free CaMPARI v0.2

calcium-free CaMPARI v0.2. Determined by X-ray diffraction at 2.03 Å resolution. Released 18 Feb 2015.

Method: X-ray diffraction
Resolution: 2.03 Å
Organisms: Rattus norvegicus, Lobophyllia hemprichii, Gallus gallus
Chains: 1
Atoms: 2,870
Mol. weight: 47.67 kDa
Released: 18 Feb 2015

Explore 4OY4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OY4 contains 14 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	5-18	14
β-strand	25-27	3	1
α-helix	28-30	3
α-helix	31-37	7
α-helix	44-52	9
β-strand	61-63	3	1
α-helix	64-76	13
α-helix	81-89	9
α-helix	138-146	9
β-strand	150-156	7	2
β-strand	159-170	12	2
β-strand	175-186	12	2
α-helix	191-194	4
β-strand	197-208	12	2
β-strand	214-224	11	2
β-strand	248-258	11	2
β-strand	261-272	12	2
β-strand	277-286	10	2
α-helix	288	1
α-helix	290	1
α-helix	294-297	4
β-strand	310	1	2
α-helix	318-321	4
β-strand	327-335	9	2
β-strand	340-350	11	2
β-strand	353-363	11	2
β-strand	376-379	4	2
α-helix	380-382	3
α-helix	391-393	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Calmodulin, GPF-like protein EosFP, and Myosin light chain kinase	A	protein	413	Rattus norvegicus, Lobophyllia hemprichii, Gallus gallus	P0DP29 (AlphaFold model), P11799 (AlphaFold model), Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4OY4_1 Chimera protein of Calmodulin, GPF-like protein EosFP, and Myosin light chain kinase (chains A)
MHHHHHHGSDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL
GEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKLECEKMYVRDGVLTGDIHMALLLE
GNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNA
RRGGTGGSMVSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLP
FAFDILTTAFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICYARNDITMEG
DTFYNKVRFYGTNFPANGPVMQKKTLKWMPSWTRSSRRKWNKTGHAVRAIGRLSS

Primary citation

Neural circuits. Labeling of active neural circuits in vivo with designed calcium integrators. Fosque, B.F., Sun, Y., Dana, H. et al. Science (2015) 347:755-760. DOI 10.1126/science.1260922 · PubMed

Other PDB entries of the same protein (UniProt P0DP29 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PQ3 1.3 Å, N-Terminal Calmodulin Zn-Trapped Intermediate
4J9Y 1.51 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
1G4Y 1.6 Å, 1.60 a crystal structure of the gating domain from small conductance potassium channel…
3B32 1.6 Å, Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues…
4G28 1.63 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4G27 1.65 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
4J9Z 1.66 Å, Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance…
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
6MBA 1.8 Å, Crystal Structure of Human Nav1.4 CTerminal Domain in Complex with apo Calmodulin
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
9U9D 1.8 Å, Bipartite Genetically Encoded Biosensor sG-GECO1

Browse structure collections

About this viewer

MolViewer shows 4OY4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.