4P6W: Glucocorticoid receptor

Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding domain. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Apr 2014.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,315
Mol. weight: 31.21 kDa
Ligands: MOF
Released: 16 Apr 2014

Explore 4P6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P6W contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	540-545	6
α-helix	556-579	24
α-helix	584-586	3
α-helix	589-615	27
β-strand	621-624	4	1
β-strand	627-629	3	1
α-helix	633-635	3
α-helix	640-655	16
α-helix	660-671	12
β-strand	674-675	2	2
α-helix	683-703	21
α-helix	708-710	3
α-helix	711-741	31
α-helix	751-766	16
β-strand	770-771	2	2

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-749	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucocorticoid receptor	A	protein	252	Homo sapiens	P04150 (AlphaFold model)
Nuclear receptor coactivator 2	B	protein	12	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4P6W_1 Glucocorticoid receptor (chains A)
PQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFR
NLHLDDQMTLLQYSWMALMAFALGWRSYRQSSANLLYFAPDLIINEQRMTLPCMYDQCKH
MLYVSSELHRLQVSYEEYLCMKVLLLLSTIPKDGLKSQELFDEIRMTYIKELGAAIVARE
GNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYS
NGNIKKLLFHQK

Sequence of entity 2 (B), FASTA

>4P6W_2 Nuclear receptor coactivator 2 (chains B)
ANALLRYLLDKD

Ligands and cofactors

ID	Name	Formula	Copies
MOF	Mometasone furoate	C27 H30 Cl2 O6	1

Primary citation

Structures and mechanism for the design of highly potent glucocorticoids. He, Y., Yi, W., Suino-Powell, K. et al. Cell Res (2014) 24:713-726. DOI 10.1038/cr.2014.52 · PubMed

Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDD 1.8 Å, GR in complex with desisobutyrylciclesonide
5E69 1.85 Å, Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
4HN5 1.9 Å, GR DNA Binding Domain - TSLP nGRE Complex
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
5CBY 2.0 Å, AncGR2 DNA Binding Domain - (+)GRE Complex
5CBX 2.0 Å, AncGR DNA Binding Domain - (+)GRE Complex
6X6E 2.0 Å, Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a…
5UC3 2.01 Å, Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P)…
6YMO 2.02 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide
6YO8 2.09 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide
3K22 2.1 Å, Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide
5NFP 2.1 Å, Glucocorticoid Receptor in complex with budesonide

Browse structure collections

About this viewer

MolViewer shows 4P6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.