Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with NDSB-201. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Jun 2015.
Explore 4P7U in 3D Show helices and sheets RCSB PDB PDBe
4P7U contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 27-29 | 3 | 1 |
| β-strand | 32-35 | 4 | 2 |
| β-strand | 43-45 | 3 | 3 |
| β-strand | 51-53 | 3 | 1 |
| β-strand | 60-67 | 8 | 2 |
| β-strand | 72-79 | 8 | 2 |
| β-strand | 85 | 1 | 4 |
| β-strand | 88 | 1 | 4 |
| β-strand | 98-99 | 2 | 3 |
| β-strand | 101-103 | 3 | 2 |
| β-strand | 109-115 | 7 | 2 |
| α-helix | 120-122 | 3 | |
| β-strand | 123-125 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-2 | A | protein | 112 | Homo sapiens | P37173 (AlphaFold model) |
>4P7U_1 TGF-beta receptor type-2 (chains A) MALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLP YHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1PS | 3-pyridinium-1-ylpropane-1-sulfonate | C8 H11 N O3 S | 1 |
The non-detergent sulfobetaine-201 acts as a pharmacological chaperone to promote folding and crystallization of the type II TGF-beta receptor extracellular domain. Wangkanont, K., Forest, K.T., Kiessling, L.L. Protein Expr Purif (2015) 115:19-25. DOI 10.1016/j.pep.2015.06.001 · PubMed
Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4P7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.