4PSF: PIH1D1 N-terminal domain

PIH1D1 N-terminal domain. Determined by X-ray diffraction at 1.58 Å resolution. Released 23 Apr 2014.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,394
Mol. weight: 30.92 kDa
Released: 23 Apr 2014

Explore 4PSF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PSF contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
β-strand	21-29	9	2
β-strand	34-42	9	2
α-helix	46-47	2
α-helix	53-62	10
β-strand	69-71	3	1
α-helix	74-76	3
β-strand	77-80	4	2
β-strand	86-95	10	2
α-helix	96-103	8
α-helix	106-124	19
β-strand	133-134	2	2

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	3
α-helix	14-15	2
β-strand	21-29	9	4
β-strand	34-42	9	4
α-helix	46-49	4
α-helix	53-61	9
β-strand	69-71	3	3
α-helix	74-76	3
β-strand	77-80	4	4
β-strand	86-95	10	4
α-helix	96-103	8
α-helix	106-124	19
β-strand	133-134	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PIH1 domain-containing protein 1	A, B	protein	138	Homo sapiens	Q9NWS0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PSF_1 PIH1 domain-containing protein 1 (chains A, B)
AHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAG
FRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNL
QLNPEWRMMKNRPFMGSI

Primary citation

Phosphorylation-Dependent PIH1D1 Interactions Define Substrate Specificity of the R2TP Cochaperone Complex. Horejsi, Z., Stach, L., Flower, T.G. et al. Cell Rep (2014) 7:19-26. DOI 10.1016/j.celrep.2014.03.013 · PubMed

Other PDB entries of the same protein (UniProt Q9NWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AVC 1.2 Å, DoBi scaffold based on PIH1D1 N-terminal domain
9THX 1.36 Å, G14 variant of 57aBi scaffold crystallized in I212121
9TIA 2.07 Å, G14 variant of 57aBi scaffold crystallized in P6422
9TJQ 2.19 Å, G14 variant of 57aBi scaffold crystallized in P6422
4PSI 2.45 Å, PIH1D1/phospho-Tel2 complex
8BDU 2.47 Å, H33 variant of DoBi scaffold based on PIH1D1 N-terminal domain
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex

Browse structure collections

About this viewer

MolViewer shows 4PSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.