PIH1D1 N-terminal domain. Determined by X-ray diffraction at 1.58 Å resolution. Released 23 Apr 2014.
Explore 4PSF in 3D Show helices and sheets RCSB PDB PDBe
4PSF contains 11 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 1 |
| β-strand | 21-29 | 9 | 2 |
| β-strand | 34-42 | 9 | 2 |
| α-helix | 46-47 | 2 | |
| α-helix | 53-62 | 10 | |
| β-strand | 69-71 | 3 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 77-80 | 4 | 2 |
| β-strand | 86-95 | 10 | 2 |
| α-helix | 96-103 | 8 | |
| α-helix | 106-124 | 19 | |
| β-strand | 133-134 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 3 |
| α-helix | 14-15 | 2 | |
| β-strand | 21-29 | 9 | 4 |
| β-strand | 34-42 | 9 | 4 |
| α-helix | 46-49 | 4 | |
| α-helix | 53-61 | 9 | |
| β-strand | 69-71 | 3 | 3 |
| α-helix | 74-76 | 3 | |
| β-strand | 77-80 | 4 | 4 |
| β-strand | 86-95 | 10 | 4 |
| α-helix | 96-103 | 8 | |
| α-helix | 106-124 | 19 | |
| β-strand | 133-134 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PIH1 domain-containing protein 1 | A, B | protein | 138 | Homo sapiens | Q9NWS0 (AlphaFold model) |
>4PSF_1 PIH1 domain-containing protein 1 (chains A, B) AHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAG FRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNL QLNPEWRMMKNRPFMGSI
Phosphorylation-Dependent PIH1D1 Interactions Define Substrate Specificity of the R2TP Cochaperone Complex. Horejsi, Z., Stach, L., Flower, T.G. et al. Cell Rep (2014) 7:19-26. DOI 10.1016/j.celrep.2014.03.013 · PubMed
Other PDB entries of the same protein (UniProt Q9NWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4PSF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.