7AVC: DoBi scaffold based on PIH1D1 N-terminal domain

DoBi scaffold based on PIH1D1 N-terminal domain. Determined by X-ray diffraction at 1.2 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 1.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,403
Mol. weight: 17.12 kDa
Released: 10 Feb 2021

Explore 7AVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7AVC contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	21-30	10	2
β-strand	34-42	9	2
α-helix	46-50	5
α-helix	53-61	9
β-strand	68-71	4	1
β-strand	72-73	2	2
α-helix	74-76	3
β-strand	77-80	4	2
β-strand	86-95	10	2
α-helix	96-102	7
α-helix	106-124	19
β-strand	128-134	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PIH1 domain-containing protein 1	AAA	protein	150	Homo sapiens	Q9NWS0 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>7AVC_1 PIH1 domain-containing protein 1 (chains AAA)
MAHHHHHHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQML
EEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRLLVIRIARQGL
EYKYDLRLAPPWDMMKNRPFMGSISQQNIR

Primary citation

Protein Binder (ProBi) as a New Class of Structurally Robust Non-Antibody Protein Scaffold for Directed Evolution. Pham, P.N., Huliciak, M., Biedermannova, L. et al. Viruses (2021) 13. DOI 10.3390/v13020190 · PubMed

Other PDB entries of the same protein (UniProt Q9NWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9THX 1.36 Å, G14 variant of 57aBi scaffold crystallized in I212121
4PSF 1.58 Å, PIH1D1 N-terminal domain
9TIA 2.07 Å, G14 variant of 57aBi scaffold crystallized in P6422
9TJQ 2.19 Å, G14 variant of 57aBi scaffold crystallized in P6422
4PSI 2.45 Å, PIH1D1/phospho-Tel2 complex
8BDU 2.47 Å, H33 variant of DoBi scaffold based on PIH1D1 N-terminal domain
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex

Browse structure collections

About this viewer

MolViewer shows 7AVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.