9TIA: PIH1 domain-containing protein 1

G14 variant of 57aBi scaffold crystallized in P6422. Determined by X-ray diffraction at 2.07 Å resolution. Released 13 May 2026.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,103
Mol. weight: 17.15 kDa
Ligands: CA
Released: 13 May 2026

Explore 9TIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TIA contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
β-strand	21-28	8	2
β-strand	29-30	2	3
β-strand	35-42	8	2
α-helix	46-47	2
α-helix	53-61	9
β-strand	69-71	3	1
β-strand	72-73	2	2
α-helix	74-76	3
β-strand	77-80	4	2
β-strand	86-95	10	2
α-helix	96-104	9
α-helix	106-124	19
β-strand	128-129	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PIH1 domain-containing protein 1	A	protein	150	Homo sapiens	Q9NWS0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TIA_1 PIH1 domain-containing protein 1 (chains A)
MAHHHHHHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQML
EEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRSLVIRIALSGL
EWKYSLWLFPAWVMMKNRPFMGSISQQNIR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (PGE) are not listed.

Primary citation

The G14 variant of 57aBi scaffold shows an unexpected higher oligomeric state in solution and domain swapping in the crystal structure. Kolenko, P., Pham, P.N., Stransky, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AVC 1.2 Å, DoBi scaffold based on PIH1D1 N-terminal domain
9THX 1.36 Å, G14 variant of 57aBi scaffold crystallized in I212121
4PSF 1.58 Å, PIH1D1 N-terminal domain
9TJQ 2.19 Å, G14 variant of 57aBi scaffold crystallized in P6422
4PSI 2.45 Å, PIH1D1/phospho-Tel2 complex
8BDU 2.47 Å, H33 variant of DoBi scaffold based on PIH1D1 N-terminal domain
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex

Browse structure collections

About this viewer

MolViewer shows 9TIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.