6GXZ: Human RPAP3(TPR2)-PIH1D1(CS) complex

Name: PDB 6GXZ: Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex
Published: 2018-08-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex. Determined by X-ray diffraction at 2.96 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.96 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,864
Mol. weight: 58.18 kDa
Ligands: CA
Released: 8 Aug 2018

Explore 6GXZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GXZ contains 23 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	285-294	10
α-helix	298-310	13
α-helix	317-328	12
α-helix	332-345	14
α-helix	350-362	13
α-helix	366-379	14
α-helix	384-399	16
α-helix	403-407	5
β-strand	416	1	1
β-strand	433-435	3	2
β-strand	437-440	4	1

Chain C: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	285-294	10
α-helix	298-311	14
α-helix	317-328	12
α-helix	332-345	14
α-helix	350-362	13
α-helix	366-379	14
α-helix	384-399	16
α-helix	403-407	5
α-helix	412-414	3
β-strand	416	1	3
β-strand	420	1	4
β-strand	433-435	3	4
β-strand	437-440	4	3

Chains D and E: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	205	1
β-strand	206	1	5
α-helix	207	1
β-strand	209-216	8	3
β-strand	219-225	7	3
β-strand	237-239	3	4
β-strand	243-246	4	4
β-strand	253	1	5
β-strand	255-258	4	4
β-strand	263	1	6
β-strand	269-273	5	3
β-strand	278-284	7	3
β-strand	285	1	6
α-helix	286-289	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II-associated protein 3	A, C	protein	165	Homo sapiens	Q9H6T3 (AlphaFold model)
PIH1 domain-containing protein 1	D, E	protein	96	Homo sapiens	Q9NWS0 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6GXZ_1 RNA polymerase II-associated protein 3 (chains A, C)
QAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCT
QAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEK
GHWDDVFLDSTQRQNVVKPIDNPPHPGSTKPLKKVIIEETGNLIQ

Sequence of entity 2 (D, E), FASTA

>6GXZ_2 PIH1 domain-containing protein 1 (chains D, E)
GPHMGRAESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYH
LDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Deep Structural Analysis of RPAP3 and PIH1D1, Two Components of the HSP90 Co-chaperone R2TP Complex. Henri, J., Chagot, M.E., Bourguet, M. et al. Structure (2018) 26:1196-1209.e8. DOI 10.1016/j.str.2018.06.002 · PubMed

Other PDB entries of the same protein (UniProt Q9H6T3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZBK 1.49 Å, Crystal structure of the human complex between RPAP3 and TRBP
6FM8 1.78 Å, RPAP3 c-terminus
4CGV 2.54 Å, First TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
4CGW 3.0 Å, Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD
6FO1 3.57 Å, Human R2TP subcomplex containing 1 RUVBL1-RUVBL2 hexamer bound to 1 RBD domain from RPAP3.
6EZ4 NMR structure of the C-terminal domain of the human RPAP3 protein
6FD7 NMR structure of the first TPR domain of the human RPAP3 protein
6FDP NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP90…
6FDT NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70…

Browse structure collections

About this viewer

MolViewer shows 6GXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.