4PSI: PIH1D1/phospho-Tel2 complex

PIH1D1/phospho-Tel2 complex. Determined by X-ray diffraction at 2.45 Å resolution. Released 23 Apr 2014.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,142
Mol. weight: 34.18 kDa
Released: 23 Apr 2014

Explore 4PSI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PSI contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-43	4	1
β-strand	52-59	8	2
β-strand	64-72	9	2
α-helix	76-81	6
β-strand	98-101	4	1
β-strand	102-103	2	2
α-helix	104-106	3
β-strand	107-110	4	2
β-strand	116-125	10	2
α-helix	126-133	8
α-helix	136-154	19
β-strand	163-165	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PIH1 domain-containing protein 1	A, B	protein	138	Homo sapiens	Q9NWS0 (AlphaFold model)
Telomere length regulation protein TEL2 homolog	D, E	protein	11	Homo sapiens	Q9Y4R8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PSI_1 PIH1 domain-containing protein 1 (chains A, B)
AHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAG
FRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNL
QLNPEWRMMKNRPFMGSI

Sequence of entity 2 (D, E), FASTA

>4PSI_2 Telomere length regulation protein TEL2 homolog (chains D, E)
ALDSDDEFVPY

Primary citation

Phosphorylation-Dependent PIH1D1 Interactions Define Substrate Specificity of the R2TP Cochaperone Complex. Horejsi, Z., Stach, L., Flower, T.G. et al. Cell Rep (2014) 7:19-26. DOI 10.1016/j.celrep.2014.03.013 · PubMed

Other PDB entries of the same protein (UniProt Q9NWS0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AVC 1.2 Å, DoBi scaffold based on PIH1D1 N-terminal domain
9THX 1.36 Å, G14 variant of 57aBi scaffold crystallized in I212121
4PSF 1.58 Å, PIH1D1 N-terminal domain
9TIA 2.07 Å, G14 variant of 57aBi scaffold crystallized in P6422
9TJQ 2.19 Å, G14 variant of 57aBi scaffold crystallized in P6422
8BDU 2.47 Å, H33 variant of DoBi scaffold based on PIH1D1 N-terminal domain
6GXZ 2.96 Å, Crystal structure of the human RPAP3(TPR2)-PIH1D1(CS) complex

Browse structure collections

About this viewer

MolViewer shows 4PSI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.