4PT6: Coagulation factor VIII

The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin with antibody-like affinities. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Apr 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,436
Mol. weight: 38.34 kDa
Released: 8 Apr 2015

Explore 4PT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PT6 contains 4 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	1
β-strand	21-23	3	1
β-strand	28-29	2	2
β-strand	32-33	2	2
α-helix	36-38	3
β-strand	40	1	1
β-strand	50	1	3
β-strand	61-77	17	1
β-strand	79-81	3	4
β-strand	84-86	3	4
β-strand	87-96	10	1
β-strand	103-104	2	1
β-strand	106-107	2	5
β-strand	110-111	2	5
α-helix	112-113	2
β-strand	114-115	2	1
β-strand	124-145	22	1
β-strand	150	1	3
β-strand	151-157	7	1

Chain B: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	6
β-strand	21-23	3	6
β-strand	28-29	2	7
β-strand	32-33	2	7
α-helix	36-38	3
β-strand	40	1	6
β-strand	50	1	8
β-strand	61-77	17	6
β-strand	79-80	2	9
β-strand	85-86	2	9
β-strand	87-96	10	6
β-strand	103-104	2	6
α-helix	111-113	3
β-strand	114-115	2	6
β-strand	124-145	22	6
β-strand	150	1	8
β-strand	151-158	8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	A, B	protein	169	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4PT6_1 Coagulation factor VIII (chains A, B)
MLNSCSMPLGMESKAISDAQITASSYACRGDTCWSPSKARLHLQGRSNAWRPQVNNPKEW
LQVDFQKTMKVTGVTTQGVKSAATSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDS
FTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYENLYFQ

Primary citation

The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin with antibody-like affinities. Kym, G., Shi, K., Kamajaya, A. et al. To be published.

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII

Browse structure collections

About this viewer

MolViewer shows 4PT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.