4Q96: CID of human RPRD1B

CID of human RPRD1B in complex with an unmodified CTD peptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 4 Jun 2014.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,795
Mol. weight: 67.03 kDa
Released: 4 Jun 2014

Explore 4Q96 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Q96 contains 44 α-helices and 6 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-15	10
β-strand	19	1	1
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-55	3
α-helix	56-70	15
α-helix	76-82	7
α-helix	85-99	15
α-helix	102-113	12
α-helix	119-128	10

Chains C and F: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1619-1620	2
β-strand	1621	1	1
α-helix	1622	1

Chain E: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-15	10
β-strand	19	1	1
α-helix	20-32	13
α-helix	34-36	3
α-helix	37-50	14
α-helix	53-55	3
α-helix	56-70	15
α-helix	76-82	7
α-helix	85-99	15
α-helix	102-113	12
α-helix	119-127	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulation of nuclear pre-mRNA domain-containing protein 1B	A, B, D, E	protein	135	Homo sapiens	Q9NQG5 (AlphaFold model)
RPB1-ctd	C, F	protein	21

Sequence of entity 1 (A, B, D, E), FASTA

>4Q96_1 Regulation of nuclear pre-mRNA domain-containing protein 1B (chains A, B, D, E)
GSSFSESALEKKLSELSNSQHSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFL
YLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGE
FIQQLKLSMEDSKSP

Sequence of entity 2 (C, F), FASTA

>4Q96_2 RPB1-CTD (chains C, F)
XSPSYSPTSPSYSPTSPSYSX

Primary citation

RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation. Ni, Z., Xu, C., Guo, X. et al. Nat Struct Mol Biol (2014) 21:686-695. DOI 10.1038/nsmb.2853 · PubMed

Other PDB entries of the same protein (UniProt Q9NQG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4Q94 1.85 Å, human RPRD1B CID in complex with a RPB1-CTD derived Ser2 phosphorylated peptide
4FU3 1.9 Å, CID of human RPRD1B
4HFG 2.0 Å, CID of human RPRD1B
4FLA 2.2 Å, Crystal structure of human RPRD1B, carboxy-terminal domain
9B9L 2.5 Å, RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide
4NAD 2.8 Å, Crystal Structure of the C-terminal Domain of CREPT

Browse structure collections

About this viewer

MolViewer shows 4Q96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.