4QVF: Bcl-xL

Crystal structure of Bcl-xL in complex with BIM BH3 domain. Determined by X-ray diffraction at 1.53 Å resolution. Released 10 Jun 2015.

Method: X-ray diffraction
Resolution: 1.53 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,503
Mol. weight: 22.59 kDa
Released: 10 Jun 2015

Explore 4QVF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4QVF contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	24-26	3
α-helix	86-104	19
α-helix	108-111	4
α-helix	119-130	12
α-helix	137-156	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	179-184	6
α-helix	188-195	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	55-73	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A	protein	169	Homo sapiens	Q07817 (AlphaFold model)
Peptide from Bcl-2-like protein 11	B	protein	26	Homo sapiens	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4QVF_1 Bcl-2-like protein 1 (chains A)
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELR
YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (B), FASTA

>4QVF_2 Peptide from Bcl-2-like protein 11 (chains B)
DMRPEIWIAQELRRIGDEFNAYYARR

Primary citation

Bh3 induced conformational changes in Bcl-Xl revealed by crystal structure and comparative analysis. Rajan, S., Choi, M., Baek, K. et al. Proteins (2015) 83:1262-1272. DOI 10.1002/prot.24816 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
9O16 1.73 Å, Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3…

Browse structure collections

About this viewer

MolViewer shows 4QVF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.