Crystal structure of APC11 RING domain. Determined by X-ray diffraction at 1.75 Å resolution. Released 29 Oct 2014.
Explore 4R2Y in 3D Show helices and sheets RCSB PDB PDBe
4R2Y contains 12 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 1 |
| β-strand | 29 | 1 | 1 |
| α-helix | 35-37 | 3 | |
| β-strand | 46-48 | 3 | 2 |
| β-strand | 49 | 1 | 3 |
| β-strand | 54-56 | 3 | 2 |
| α-helix | 57-67 | 11 | |
| β-strand | 72 | 1 | 4 |
| β-strand | 79 | 1 | 4 |
| α-helix | 80 | 1 | |
| β-strand | 82 | 1 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 6 |
| β-strand | 29 | 1 | 6 |
| β-strand | 46-48 | 3 | 7 |
| β-strand | 49 | 1 | 5 |
| β-strand | 54-56 | 3 | 7 |
| α-helix | 57-67 | 11 | |
| α-helix | 68-71 | 4 | |
| β-strand | 72 | 1 | 8 |
| β-strand | 79 | 1 | 8 |
| α-helix | 80 | 1 | |
| β-strand | 82 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 9 |
| β-strand | 29 | 1 | 9 |
| β-strand | 46-48 | 3 | 10 |
| β-strand | 49 | 1 | 11 |
| β-strand | 54-56 | 3 | 10 |
| α-helix | 57-67 | 11 | |
| α-helix | 71 | 1 | |
| β-strand | 72 | 1 | 12 |
| α-helix | 73 | 1 | |
| β-strand | 79 | 1 | 12 |
| α-helix | 80 | 1 | |
| β-strand | 82 | 1 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 14 |
| β-strand | 29 | 1 | 14 |
| β-strand | 46-48 | 3 | 15 |
| β-strand | 49 | 1 | 13 |
| β-strand | 54-56 | 3 | 15 |
| α-helix | 57-67 | 11 | |
| α-helix | 68-71 | 4 | |
| β-strand | 72 | 1 | 16 |
| β-strand | 79 | 1 | 16 |
| β-strand | 82 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Anaphase-promoting complex subunit 11 | A, B, C, D | protein | 68 | Homo sapiens | Q9NYG5 (AlphaFold model) |
>4R2Y_1 Anaphase-promoting complex subunit 11 (chains A, B, C, D) VANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMC RQEWKFKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 12 |
Mechanism of Polyubiquitination by Human Anaphase-Promoting Complex: RING Repurposing for Ubiquitin Chain Assembly. Brown, N.G., Watson, E.R., Weissmann, F. et al. Mol Cell (2014) 56:246-260. DOI 10.1016/j.molcel.2014.09.009 · PubMed
Other PDB entries of the same protein (UniProt Q9NYG5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4R2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.