4RHV: Human rhinovirus 14 coat protein

Name: PDB 4RHV: The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure
Published: 1988-04-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Apr 1988.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Human rhinovirus 14
Chains: 4
Atoms: 6,542
Mol. weight: 94.48 kDa
Released: 16 Apr 1988

Explore 4RHV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RHV contains 37 α-helices and 63 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	18-20	3	1
β-strand	23	1	2
β-strand	34-35	2	3
α-helix	37-39	3
α-helix	47-49	3
β-strand	53	1	2
β-strand	56-57	2	1
α-helix	63-65	3
β-strand	66	1	4
α-helix	67-71	5
β-strand	75-84	10	5
α-helix	94-96	3
β-strand	99-103	5	6
α-helix	110-116	7
β-strand	119-135	17	5
β-strand	147-152	6	6
β-strand	155	1	7
β-strand	157	1	7
α-helix	158-160	3
α-helix	166-169	4
β-strand	175-179	5	6
β-strand	180	1	8
β-strand	182	1	8
β-strand	183-188	6	5
β-strand	197-198	2	5
β-strand	203	1	9
α-helix	217-219	3
β-strand	223-228	6	6
β-strand	237-255	19	5
α-helix	257-258	2
β-strand	259	1	10
α-helix	262-263	2
α-helix	280-282	3

Chain 2: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	11
β-strand	21-25	5	11
β-strand	32-33	2	12
α-helix	34-36	3
α-helix	44-46	3
α-helix	52-53	2
β-strand	54	1	12
α-helix	57-59	3
β-strand	64-65	2	12
α-helix	66-68	3
β-strand	69-72	4	13
β-strand	78-82	5	14
α-helix	84-86	3
α-helix	90-98	9
β-strand	99-111	13	12
β-strand	119-128	10	14
β-strand	134	1	15
α-helix	144-147	4
α-helix	150-152	3
β-strand	154-155	2	14
α-helix	159-160	2
β-strand	165	1	15
α-helix	166	1
α-helix	169-171	3
β-strand	176	1	10
α-helix	178-183	6
β-strand	186-190	5	14
β-strand	196-201	6	12
β-strand	210	1	12
β-strand	215	1	9
β-strand	218-229	12	14
α-helix	230-231	2
β-strand	237-240	4	13
β-strand	241-254	14	12

Chain 3: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	23	1	5
α-helix	30-33	4
β-strand	39-40	2	5
β-strand	42	1	4
α-helix	43-46	4
β-strand	51-52	2	3
α-helix	64-66	3
β-strand	68-72	5	3
β-strand	73	1	16
β-strand	79-84	6	17
α-helix	92-94	3
α-helix	96-101	6
β-strand	104-108	5	18
β-strand	111-117	7	3
β-strand	124	1	19
β-strand	126-132	7	17
α-helix	137-139	3
α-helix	142-146	5
β-strand	149-154	6	17
β-strand	160-165	6	3
β-strand	174-175	2	18
β-strand	186-191	6	17
β-strand	195	1	16
β-strand	196	1	19
α-helix	197-198	2
β-strand	204-213	10	3
β-strand	218-222	5	18

Chain 4: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	50-53	4
β-strand	56	1	12
β-strand	62	1	20
β-strand	64	1	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human rhinovirus 14 coat protein (subunit VP1)	1	protein	289	Human rhinovirus 14	P03303 (AlphaFold model)
Human rhinovirus 14 coat protein (subunit VP2)	2	protein	262	Human rhinovirus 14	P03303 (AlphaFold model)
Human rhinovirus 14 coat protein (subunit VP3)	3	protein	236	Human rhinovirus 14	P03303 (AlphaFold model)
Human rhinovirus 14 coat protein (subunit VP4)	4	protein	68	Human rhinovirus 14	P03303 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>4RHV_1 HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1) (chains 1)
GLGDELEEVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHF
NGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFT
YVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKV
GDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVK
IRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY

Sequence of entity 2 (2), FASTA

>4RHV_2 HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP2) (chains 2)
SPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSV
CRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSG
CLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVLYNMNGTLLGN
LLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPI
TVTIAPMCTEFSGIRSKSIVPQ

Sequence of entity 3 (3), FASTA

>4RHV_3 HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP3) (chains 3)
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHT
KDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDT
YTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE

Sequence of entity 4 (4), FASTA

>4RHV_4 HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP4) (chains 4)
GAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLM
LKGAPALN

Primary citation

The use of molecular-replacement phases for the refinement of the human rhinovirus 14 structure. Arnold, E., Rossmann, M.G. Acta Crystallogr A (1988) 44:270-282. DOI 10.1107/S0108767387011875 · PubMed

Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
5W3E 2.53 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
7BG6 2.6 Å, HRV14 native particle solved by cryoEM
31LE 2.64 Å, HRV E1007A mutant
1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
31LF 2.71 Å, HRV virion E2250A mutant
5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…

Browse more

4RHV is part of these collections:

Viruses

About this viewer

MolViewer shows 4RHV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.