4RZ9: Pre-mRNA-splicing factor 38A AS 1-179

Pre-mRNA-splicing factor 38A AS 1-179. Determined by X-ray diffraction at 1.28 Å resolution. Released 2 Dec 2015.

Method: X-ray diffraction
Resolution: 1.28 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,999
Mol. weight: 21.16 kDa
Released: 2 Dec 2015

Explore 4RZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RZ9 contains 16 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
α-helix	9-11	3
β-strand	12	1	1
β-strand	15	1	1
α-helix	17-20	4
α-helix	23-30	8
α-helix	33-38	6
α-helix	44-46	3
α-helix	47-51	5
β-strand	57-58	2	2
β-strand	60-61	2	3
β-strand	66-67	2	3
α-helix	68	1
α-helix	69-80	12
α-helix	84-92	9
α-helix	97-110	14
α-helix	113-120	8
α-helix	121-125	5
β-strand	129-133	5	2
β-strand	139-143	5	2
α-helix	144-153	10
β-strand	156-157	2	4
β-strand	160-161	2	4
α-helix	162-164	3
α-helix	168-173	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-splicing factor 38A	A	protein	179	Homo sapiens	Q8NAV1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RZ9_1 Pre-mRNA-splicing factor 38A (chains A)
MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL
EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEP

Primary citation

The N-terminal domain of the unusual SR protein hPrp38 is an interaction hub in the spliceosome. Schuetze, T., Apelt, L., Ulrich, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q8NAV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RZA 1.9 Å, Pre-mRNA-splicing factor 38A AS 1-205
5F5S 2.4 Å, Crystal structure of the Prp38-MFAP1 complex of Homo sapiens
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
6AHD 3.8 Å, The Cryo-EM Structure of Human Pre-catalytic Spliceosome (B complex) at 3.8 angstrom…
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QZS 4.1 Å, Cryo-EM structure of the cross-exon B-like complex
7AAV 4.2 Å, Human pre-Bact-2 spliceosome core structure
5O9Z 4.5 Å, Cryo-EM structure of a pre-catalytic human spliceosome primed for activation (B complex)
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer

Browse structure collections

About this viewer

MolViewer shows 4RZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.