4TX5: Smac-DIABLO

Name: PDB 4TX5: Crystal structure of Smac-DIABLO (in space group P65)
Published: 2015-07-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal structure of Smac-DIABLO (in space group P65). Determined by X-ray diffraction at 1.8 Å resolution. Released 15 Jul 2015.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,120
Mol. weight: 44.66 kDa
Released: 15 Jul 2015

Explore 4TX5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4TX5 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	16-65	50
α-helix	71-118	48
α-helix	122-185	64

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	15-64	50
α-helix	71-118	48
α-helix	122-178	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Diablo homolog, mitochondrial	A, B	protein	192	Homo sapiens	Q9NR28 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4TX5_1 Diablo homolog, mitochondrial (chains A, B)
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYR
QYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAY
LREDLEHHHHHH

Primary citation

The activator of apoptosis Smac-DIABLO acts as a tetramer in solution. Mastrangelo, E., Vachette, P., Cossu, F. et al. Biophys J (2015) 108:714-723. DOI 10.1016/j.bpj.2014.11.3471 · PubMed

Other PDB entries of the same protein (UniProt Q9NR28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
1G73 2.0 Å, Crystal structure of smac bound to xiap-BIR3 domain
1FEW 2.2 Å, Crystal structure of smac/diablo
1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
3D9U 2.3 Å, The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2
3UIJ 2.71 Å, Crystal structure of human Survivin K62Y/H80W mutant in complex with Smac/DIABLO(1-15)…
6JX6 2.81 Å, Tetrameric form of Smac
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac

Browse structure collections

About this viewer

MolViewer shows 4TX5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.