Crystal structure of the PDZ domain of PALS1. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Jan 2015.
Explore 4UU6 in 3D Show helices and sheets RCSB PDB PDBe
4UU6 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 255-261 | 7 | 1 |
| β-strand | 269-274 | 6 | 1 |
| β-strand | 277-283 | 7 | 1 |
| α-helix | 288-292 | 5 | |
| α-helix | 299 | 1 | |
| β-strand | 300-304 | 5 | 1 |
| β-strand | 307-308 | 2 | 1 |
| α-helix | 314-322 | 9 | |
| β-strand | 326-333 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maguk P55 subfamily member 5 | A | protein | 90 | HOMO SAPIENS | Q8N3R9 (AlphaFold model) |
>4UU6_1 MAGUK P55 SUBFAMILY MEMBER 5 (chains A) GPLGSGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEIN GIEIRGKDVNEVFDLLSDMHGTLTFVLIPS
Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove. Ivanova, M.E., Fletcher, G.C., O'Reilly, N. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:555-564. DOI 10.1107/S139900471402776X · PubMed
Other PDB entries of the same protein (UniProt Q8N3R9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.