4UU5: PDZ domain of PALS1

Crystal structure of the PDZ domain of PALS1 in complex with the crb peptide. Determined by X-ray diffraction at 1.23 Å resolution. Released 14 Jan 2015.

Method: X-ray diffraction
Resolution: 1.23 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,058
Mol. weight: 12.28 kDa
Ligands: PUN
Released: 14 Jan 2015

Explore 4UU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UU5 contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	255-261	7	1
β-strand	269-274	6	1
β-strand	277-283	7	1
α-helix	288-292	5
β-strand	300-304	5	1
β-strand	307-308	2	1
α-helix	314-322	9
β-strand	326-333	8	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1398-1402	5
β-strand	1403-1405	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maguk P55 subfamily member 5	A	protein	90	HOMO SAPIENS	Q8N3R9 (AlphaFold model)
Protein crumbs homolog 1	B	protein	17	HOMO SAPIENS	P82279 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UU5_1 MAGUK P55 SUBFAMILY MEMBER 5 (chains A)
GPLGSGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEIN
GIEIRGKDVNEVFDLLSDMHGTLTFVLIPS

Sequence of entity 2 (B), FASTA

>4UU5_2 PROTEIN CRUMBS HOMOLOG 1 (chains B)
RVEMWNLMPPPAMERLI

Ligands and cofactors

ID	Name	Formula	Copies
PUN	2,2,4,4,6,6,8-heptamethylnonane	C16 H34	1

Water and common crystallization additives (CL, NA) are not listed.

Primary citation

Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove. Ivanova, M.E., Fletcher, G.C., O'Reilly, N. et al. Acta Crystallogr D Biol Crystallogr (2015) 71:555-564. DOI 10.1107/S139900471402776X · PubMed

Other PDB entries of the same protein (UniProt Q8N3R9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NTJ 1.74 Å, PALS1 PDZ1 domain with SARS-CoV-1_E PBM complex
4UU6 1.8 Å, Crystal structure of the PDZ domain of PALS1
7NTK 1.9 Å, PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex
3UIT 2.05 Å, Overall structure of Patj/Pals1/Mals complex
7QCS 2.8 Å, PALS1/MPP5 PDZ domain in complex with SARS-CoV-2_E PBM peptide
4WSI 2.95 Å, Crystal Structure of PALS1/Crb complex
7M4R 3.65 Å, Structural basis for SARS-CoV-2 envelope protein in recognition of human cell junction…
1Y76 Solution Structure of Patj/Pals1 L27 Domain Complex

Browse structure collections

About this viewer

MolViewer shows 4UU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.