4WSI: PALS1/Crb complex

Crystal Structure of PALS1/Crb complex. Determined by X-ray diffraction at 2.95 Å resolution. Released 26 Nov 2014.

Method: X-ray diffraction
Resolution: 2.95 Å
Organisms: Homo sapiens, Drosophila melanogaster
Chains: 4
Atoms: 6,042
Mol. weight: 99.44 kDa
Released: 26 Nov 2014

Explore 4WSI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WSI contains 37 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	245-246	2	1
β-strand	254-261	8	1
β-strand	262	1	2
β-strand	265	1	2
β-strand	269-274	6	1
β-strand	277-283	7	1
α-helix	288-292	5
β-strand	300-304	5	1
β-strand	307-308	2	1
α-helix	314-322	9
β-strand	326-333	8	1
α-helix	339-340	2
β-strand	348-352	5	3
β-strand	356	1	4
α-helix	358-360	3
α-helix	367-369	3
β-strand	370	1	3
β-strand	373	1	4
β-strand	378-383	6	3
β-strand	389-394	6	3
β-strand	405-408	4	3
β-strand	464	1	5
β-strand	466-468	3	6
β-strand	469-472	4	7
α-helix	473-475	3
α-helix	479-481	3
β-strand	482-485	4	8
α-helix	492-502	11
β-strand	507-508	2	9
β-strand	513-514	2	10
α-helix	517-518	2
β-strand	529-530	2	10
α-helix	533-541	9
β-strand	545-551	7	10
β-strand	554-559	6	10
α-helix	560-567	8
β-strand	572-573	2	9
β-strand	574-576	3	8
α-helix	579-581	3
α-helix	582-586	5
β-strand	593-598	6	8
α-helix	602-608	7
α-helix	621-631	11
α-helix	634-636	3
β-strand	641-644	4	8
α-helix	648-660	13
β-strand	667-670	4	7
α-helix	671-673	3

Chain B: 15 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	255-261	7	11
β-strand	262	1	12
β-strand	265	1	12
β-strand	269-274	6	11
β-strand	277-283	7	11
α-helix	284	1
α-helix	288-292	5
β-strand	300-304	5	11
β-strand	307-308	2	11
α-helix	314-322	9
β-strand	326-333	8	11
β-strand	348-352	5	6
β-strand	356	1	13
α-helix	367-369	3
β-strand	370	1	6
β-strand	373	1	13
β-strand	378-383	6	6
β-strand	389-394	6	6
β-strand	405-408	4	6
β-strand	463	1	5
β-strand	466-468	3	3
β-strand	469-472	4	14
α-helix	479-481	3
β-strand	482-485	4	15
α-helix	492-502	11
β-strand	507-508	2	16
β-strand	513-514	2	17
α-helix	517-518	2
β-strand	529-530	2	17
α-helix	533-541	9
β-strand	545-551	7	17
β-strand	554-559	6	17
α-helix	560-567	8
β-strand	572-573	2	16
β-strand	574-576	3	15
α-helix	579-581	3
α-helix	582-586	5
β-strand	593-598	6	15
α-helix	602-607	6
α-helix	618-631	14
α-helix	634-636	3
β-strand	641-644	4	15
α-helix	648-664	17
β-strand	667-670	4	14

Chain X: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2131-2135	5
α-helix	2139-2143	5
β-strand	2144-2145	2	1

Chain Y: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2131-2136	6
α-helix	2139-2142	4
β-strand	2144-2145	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MAGUK p55 subfamily member 5	A, B	protein	394	Homo sapiens	Q8N3R9 (AlphaFold model)
Protein crumbs	X, Y	protein	43	Drosophila melanogaster	P10040 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4WSI_1 MAGUK p55 subfamily member 5 (chains A, B)
GPGSPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEK
SGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVK
AHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKE
EILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQ
EVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQS
LKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDT
AIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR

Sequence of entity 2 (X, Y), FASTA

>4WSI_2 Protein crumbs (chains X, Y)
GPGSEFRNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI

Primary citation

Structure of Crumbs tail in complex with the PALS1 PDZ-SH3-GK tandem reveals a highly specific assembly mechanism for the apical Crumbs complex. Li, Y., Wei, Z., Yan, Y. et al. Proc Natl Acad Sci U S A (2014) 111:17444-17449. DOI 10.1073/pnas.1416515111 · PubMed

Other PDB entries of the same protein (UniProt Q8N3R9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UU5 1.23 Å, Crystal structure of the PDZ domain of PALS1 in complex with the crb peptide
7NTJ 1.74 Å, PALS1 PDZ1 domain with SARS-CoV-1_E PBM complex
4UU6 1.8 Å, Crystal structure of the PDZ domain of PALS1
7NTK 1.9 Å, PALS1 PDZ1 domain with SARS-CoV-2_E PBM complex
3UIT 2.05 Å, Overall structure of Patj/Pals1/Mals complex
7QCS 2.8 Å, PALS1/MPP5 PDZ domain in complex with SARS-CoV-2_E PBM peptide
7M4R 3.65 Å, Structural basis for SARS-CoV-2 envelope protein in recognition of human cell junction…
1Y76 Solution Structure of Patj/Pals1 L27 Domain Complex

Browse structure collections

About this viewer

MolViewer shows 4WSI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.