4WNF: Oxidized TPR domain of LGN

Crystal structure of the oxidized TPR domain of LGN in complex with Frmpd4/Preso1 at 2.9 Angstrom resolution. Determined by X-ray diffraction at 2.9 Å resolution. Released 16 Sept 2015.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,065
Mol. weight: 50.78 kDa
Released: 16 Sept 2015

Explore 4WNF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WNF contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	13-29	17
α-helix	33-46	14
α-helix	51-67	17
α-helix	71-87	17
α-helix	91-108	18
α-helix	111-127	17
α-helix	131-150	20
α-helix	158-161	4
α-helix	165-188	24
α-helix	191-208	18
α-helix	211-228	18
α-helix	231-248	18
α-helix	251-266	16

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	998-1001	4
α-helix	1007-1009	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2	A	protein	406	Homo sapiens	P81274 (AlphaFold model)
FERM and PDZ domain-containing protein 4	B	protein	53	Homo sapiens	Q14CM0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WNF_1 G-protein-signaling modulator 2 (chains A)
GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYL
HDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISREL
NDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTAL
GDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFL
GEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEL
NDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVL
GLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEK

Sequence of entity 2 (B), FASTA

>4WNF_2 FERM and PDZ domain-containing protein 4 (chains B)
GPLGSDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVAYSCTS

Primary citation

Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN. Takayanagi, H., Yuzawa, S., Sumimoto, H. Acta Crystallogr F Struct Biol Commun (2015) 71:175-183. DOI 10.1107/S2053230X14028143 · PubMed

Other PDB entries of the same protein (UniProt P81274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WND 1.5 Å, Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 1.5 Angstrom…
4WNE 2.0 Å, Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 2.0 Angstrom…
4WNG 2.11 Å, Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 2.1 Angstrom…
3SF4 2.6 Å, Crystal structure of the complex between the conserved cell polarity proteins…
5A6C 2.9 Å, Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation
6HC2 4.31 Å, Crystal structure of NuMA/LGN hetero-hexamers

Browse structure collections

About this viewer

MolViewer shows 4WNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.