6PFP: Myosin-7 fused to GP7 and EB1

Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and Eb1. Determined by X-ray diffraction at 2.2 Å resolution. Released 24 Jun 2020.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,518
Mol. weight: 77.82 kDa
Released: 24 Jun 2020

Explore 6PFP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PFP contains 17 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	5-15	11
α-helix	22-2136	115
α-helix	2138-2140	3
α-helix	2143-2152	10

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	5-16	12
α-helix	22-2136	115
α-helix	2138-2140	3
α-helix	2143-2153	11

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	5-14	10
α-helix	22-2136	115
α-helix	2138-2140	3
α-helix	2143-2153	11

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-15	11
α-helix	22-2136	115
α-helix	2138-2140	3
α-helix	2143-2153	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7 fused to GP7 and EB1	A, B, C, D	protein	166	Homo sapiens	P12883 (AlphaFold model), P13848, Q15691 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6PFP_1 Myosin-7  fused to GP7 and EB1 (chains A, B, C, D)
GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKEARSLSTEL
FKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEVEDLE
KERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD

Primary citation

A Complete Model of the Cardiac Myosin Rod. Andreas, M.P., Korkmaz, E.N., Kirsch, C.J. et al. To be published.

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7
9HTG 2.6 Å, Beta-cardiac myosin E497D mutant motor domain in the pre-powerstroke state, MgADP.VO4 form

Browse structure collections

About this viewer

MolViewer shows 6PFP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.