5CJ1: Gp7-MYH7- chimera protein

Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Dec 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Bacillus phage phi29, Homo sapiens
Chains: 8
Atoms: 6,512
Mol. weight: 92.38 kDa
Released: 2 Dec 2015

Explore 5CJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CJ1 contains 26 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-14	10
α-helix	22-1570	76

Chains B and D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-16	12
α-helix	22-1555	61
α-helix	1557-1570	14

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-16	12
α-helix	22-1569	75

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-15	11
α-helix	22-1555	61
α-helix	1557-1570	14

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-15	11
α-helix	22-1570	76

Chain G: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-4	3
α-helix	5-14	10
α-helix	22-1569	75

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-16	12
α-helix	22-1555	61
α-helix	1557-1569	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gp7-MYH7-(1526-1571) chimera protein	A, B, C, D, E, F, G, H	protein	101	Bacillus phage phi29, Homo sapiens	P12883 (AlphaFold model), P13848

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>5CJ1_1 Gp7-MYH7-(1526-1571) chimera protein (chains A, B, C, D, E, F, G, H)
GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHEKLEKVR
KQLEAEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAE

Primary citation

A composite approach towards a complete model of the myosin rod. Korkmaz, E.N., Taylor, K.C., Andreas, M.P. et al. Proteins (2016) 84:172-189. DOI 10.1002/prot.24964 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7
9HTG 2.6 Å, Beta-cardiac myosin E497D mutant motor domain in the pre-powerstroke state, MgADP.VO4 form

Browse structure collections

About this viewer

MolViewer shows 5CJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.