9HTF: Myosin-7

Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form. Determined by X-ray diffraction at 2.48 Å resolution. Released 22 Oct 2025.

Method: X-ray diffraction
Resolution: 2.48 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,706
Mol. weight: 94.14 kDa
Ligands: VO4, ADP, MG
Released: 22 Oct 2025

Explore 9HTF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HTF contains 37 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	37-39	3	1
β-strand	47-48	2	1
β-strand	77-78	2	1
α-helix	79-81	3
α-helix	82-84	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-110	13
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	136-142	7
α-helix	147-149	3
α-helix	154-168	15
β-strand	172-177	6	2
β-strand	179	1	3
α-helix	184-201	18
α-helix	216-231	16
β-strand	232-233	2	4
β-strand	241-242	2	4
β-strand	245-252	8	2
β-strand	258-266	9	2
α-helix	271-274	4
β-strand	283	1	4
α-helix	284-289	6
α-helix	295-301	7
α-helix	307-309	3
α-helix	311-313	3
α-helix	325-338	14
α-helix	343-360	18
β-strand	364-366	3	5
β-strand	373-375	3	5
α-helix	379-388	10
α-helix	392-400	9
β-strand	403-406	4	6
β-strand	409-412	4	6
α-helix	417-447	31
β-strand	455-461	7	2
α-helix	462-464	3
β-strand	465	1	3
α-helix	473-490	18
α-helix	491-496	6
α-helix	497-503	7
α-helix	518-525	8
α-helix	530-538	9
α-helix	545-556	12
β-strand	563-564	2	7
β-strand	577-581	5	7
β-strand	584-588	5	7
α-helix	593-598	6
α-helix	603-611	9
α-helix	615-620	6
α-helix	647-663	17
β-strand	666-673	8	2
α-helix	686-696	11
α-helix	698-707	10
β-strand	711-714	4	8
α-helix	715-722	8
α-helix	723-725	3
α-helix	738-748	11
β-strand	756-758	3	8
β-strand	762-765	4	8
α-helix	766	1
α-helix	769-778	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7	A	protein	819	Homo sapiens	P12883 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9HTF_1 Myosin-7 (chains A)
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT
AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIHTYSGL
FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLARMEYKKLLERRGSGRGSIDTWV

Ligands and cofactors

ID	Name	Formula	Copies
VO4	Vanadate ion	O4 V	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (EDO, GOL) are not listed.

Primary citation

Hypertrophic cardiomyopathy mutations Y115H and E497D disrupt the folded-back state of human beta-cardiac myosin allosterically. Nandwani, N., Bhowmik, D., Glaser, C. et al. Nat Commun (2025) 16:8751-8751. DOI 10.1038/s41467-025-63816-1 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7
9HTG 2.6 Å, Beta-cardiac myosin E497D mutant motor domain in the pre-powerstroke state, MgADP.VO4 form

Browse structure collections

About this viewer

MolViewer shows 9HTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.