B-Raf Kinase domain in complex with PLX5568. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Oct 2015.
Explore 4XV9 in 3D Show helices and sheets RCSB PDB PDBe
4XV9 contains 14 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 451 | 1 | 1 |
| β-strand | 458-466 | 9 | 1 |
| β-strand | 469-475 | 7 | 1 |
| β-strand | 479-485 | 7 | 1 |
| α-helix | 492-505 | 14 | |
| β-strand | 513 | 1 | 2 |
| β-strand | 516-520 | 5 | 1 |
| β-strand | 526-530 | 5 | 1 |
| α-helix | 531-533 | 3 | |
| β-strand | 536 | 1 | 2 |
| α-helix | 537-542 | 6 | |
| α-helix | 550-569 | 20 | |
| α-helix | 579-581 | 3 | |
| β-strand | 582-585 | 4 | 2 |
| β-strand | 589-592 | 4 | 2 |
| α-helix | 614-619 | 6 | |
| α-helix | 622-626 | 5 | |
| α-helix | 635-651 | 17 | |
| α-helix | 662-671 | 10 | |
| α-helix | 678-680 | 3 | |
| α-helix | 687-696 | 10 | |
| α-helix | 701-703 | 3 | |
| α-helix | 705-706 | 2 | |
| α-helix | 707-721 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase B-raf | A | protein | 292 | Homo sapiens | P15056 (AlphaFold model) |
>4XV9_1 Serine/threonine-protein kinase B-raf (chains A) MKKGHHHHHHGSRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPT PQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMK KLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSRWSGSHQFE QLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGR GSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1OO | N-{3-[(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)carbonyl]-2,4-difluorophenyl}-4-(… | C21 H11 Cl F5 N3 O3 S | 1 |
Water and common crystallization additives (SO4) are not listed.
RAF inhibitors that evade paradoxical MAPK pathway activation. Zhang, C., Spevak, W., Zhang, Y. et al. Nature (2015) 526:583-586. DOI 10.1038/nature14982 · PubMed
Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4XV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.